| PDBID: | 9gni | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9gnj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9gnq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9gnk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9gnr | | Status: | PROC -- to be processed | | Title: | Cryo-EM structure of Sporosarcina pasteurii urease inhibited by NBPTO | | Authors: | Mazzei, L., Tria, G., Ciurli, S., Cianci, M. | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9gnh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9gng | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | mouse VDAC1 in complex with MPD | | Authors: | Lolicato, M., Arrigoni, C. | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9gnm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray crystal structure of VvPYL1-ABA | | Authors: | Rivera-Moreno, M., Benavente, J.L., Infantes, L., Albert, A. | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9gnl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray crystal structure of VvPYL1-ABA | | Authors: | Rivera-Moreno, M., Benavente, J.L., Infantes, L., Albert, A. | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9gnp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9gno | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CDK2 bound by (2R)-2-[(9-isopropyl-6-{[(3S)-1-(methylsulfonyl)-3-pyrrolidinyl]amino}-9H-purin-2-yl)amino]-3-methyl-1-butanol. | | Authors: | Collie, G.W., Pflug, A. | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9gnn | | Status: | HOLD -- hold until a certain date | | Title: | Structure of SENP5 in complex with SUMO2 | | Authors: | Reverter, D., Li, Y., Sanchez-Alba, L. | | Deposition date: | 2024-09-03 | | Release date: | 2025-09-03 |
|
| PDBID: | 9jee | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9jek | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9jez | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9jei | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Integrin alpha-v beta-3 in complex with Echistatin | | Authors: | Wang, Y.T., Chuang, W.J. | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9jem | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Co-crystal structure of PHBDD-L163G with product N-isopropyl-4-methylbenzamide | | Authors: | Yang, J., Qiu, X., Gao, L. | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9jel | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The complex structure of Y510-9709 and NET determined with Cryo-EM | | Authors: | Jia, Y., Gao, B., Tan, J., Hong, X., Zhu, W., Tan, H., Xiao, Y., Huang, Y., Jin, Y., Yuan, Y., Tian, J., Ma, W., Zhang, Y., Yan, C., Zhang, W., Lan, Y. | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9jef | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9jeg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9jej | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-03 | | Release date: | 2025-09-03 |
|
| PDBID: | 9jeo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Chito oligosaccharide deacetylase from vibrio campbellii (VhCOD) in complex with D-N-Acetylglucosaminyl-D-Glucosamine (GlcNAcGlcN) | | Authors: | Sirikan, P., Tamo, F., Robinson, R.C., Wipa, S. | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9jes | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of rice DWARF14 in complex with Cyclo(L-Leu-L-Pro) | | Authors: | Wang, Q.X., Wang, M.Y., Feng, J.X., Wang, B., Bai, Y., Gao, S. | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9jec | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of canine TNF-alpha complexed with nanobody TNF30K | | Authors: | Weng, J., Li, Z., Xu, J., Wei, Z. | | Deposition date: | 2024-09-03 | | Release date: | 2025-09-03 |
|
| PDBID: | 9jer | | Status: | HPUB -- hold until publication | | Title: | Arginine decarboxylase in Aspergillus oryzae, ligand-free form | | Authors: | Mikami, B., Yaukawa, K., Fujiwara, S., Takita, T., Mizutani, K., Odagaki, Y., Murakami, Y. | | Deposition date: | 2024-09-03 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMQSVRIIPTYIERAPGAPATGSSLHSHGHWMPENVELRRAWLSSLLDKTKAEIPRKLRDNVENPVETFRKLIENDSTLYMLAHSMFDEVPEKAPYDRDPTTLKKQVRNYKTMLYLFNTLLTEVPEYFLRDNPNVPSGLIGFPFNIIVDWPMGTPSGRQFFLDTRVNKCLKDILNKWNEFLKDPTAQGNGNKGGNQALIDAGWSSDAAVEQLVNKANESTTDKKKTFSEIFQHPANGTQENFFNYACWDNFFTRRFKDGVRPVADAAVVNACESFPLSFDTDVSRRNTFWLKGTPYSLHDMLGATQDERVASYVDGFVGGSVYQAFLSADSYHCWNAPVTGKVVYRSLIDGTYFAETAAAGFGGSNGPDPAGPDVSQRYITHIAARGVLIVDTNVTGGAKIGLVGFVPVGMSEVSTCDWFDNTEEGKTISKGDVIGAFHSGGS
>Entity 2
THCLIFQRDAVKKLQFIPKAQYPEIATTNLAVNSELAKLTS
|
|
