PDBID: | 8x9v | Status: | HPUB -- hold until publication | Title: | Crystal structure of Xanthomonas oryzae pv. oryzae NADH-quinone oxidoreductase subunits NuoE and NuoF | Authors: | Li, L., Ran, T., Wang, W., Zhang, F. | Deposition date: | 2023-12-01 |
|
PDBID: | 8rah | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8rag | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8ral | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8ray | Status: | HPUB -- hold until publication | Title: | ParA in complex with ATP | Authors: | Mais, C.-N., Bange, G. | Deposition date: | 2023-12-01 |
|
PDBID: | 8ram | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8rap | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of Sen1-ADP.BeF3 bound RNA Polymerase II pre-termination complex | Authors: | Rengachari, S., Lidscreiber, M., Cramer, P. | Deposition date: | 2023-12-01 |
|
PDBID: | 8ran | Status: | HPUB -- hold until publication | Title: | Structure of Sen1-RNA complex | Authors: | Rengachari, S., Lidscreiber, M., Cramer, P. | Deposition date: | 2023-12-01 |
|
PDBID: | 8rao | Status: | HPUB -- hold until publication | Title: | Structure of Sen1-ADP.BeF3-RNA complex | Authors: | Rengachari, S., Lidscreiber, M., Cramer, P. | Deposition date: | 2023-12-01 |
|
PDBID: | 8rau | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8rar | Status: | HPUB -- hold until publication | Title: | Crystal structure of chimeric human carbonic anhydrase IX with N-butyl-4-chloro-2-(cyclohexylsulfanyl)-5-sulfamoylbenzamide | Authors: | Manakova, E.N., Smirnov, A., Paketuryte, V., Grazulis, S. | Deposition date: | 2023-12-01 | Sequence: | >Entity 1 MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
PDBID: | 8rav | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8raw | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8rax | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8raz | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8rb2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8rb0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8rb1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8raq | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8v65 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8v66 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8v67 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8v68 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8v69 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8v5v | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|