PDBID: | 8t9s | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-24 |
|
PDBID: | 8t8t | Status: | HPUB -- hold until publication | Title: | Crystal structure of TET25 in complex with PyDH2 ligand in P212121 space group | Authors: | Lam, G., Yatsunyk, L.A. | Deposition date: | 2023-06-23 |
|
PDBID: | 8t9g | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-23 | Release date: | 2024-12-18 |
|
PDBID: | 8pin | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pis | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pio | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pir | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pj3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pj2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pj4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pj5 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pj6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8jtq | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pj1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8jtu | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-09-24 |
|
PDBID: | 8t8j | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-22 | Release date: | 2024-12-18 |
|
PDBID: | 8pie | Status: | HPUB -- hold until publication | Title: | Crystal structure of the human nucleoside diphosphate kinase B domain in complex with the product AT-8500 formed by catalysis of compound AT-9010 | Authors: | Feracci, M., Chazot, A., Ferron, F., Alvarez, K., Canard, B. | Deposition date: | 2023-06-21 | Release date: | 2024-12-26 |
|
PDBID: | 8jti | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-21 | Release date: | 2024-12-21 |
|
PDBID: | 8pik | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-21 | Release date: | 2024-12-21 |
|
PDBID: | 8t7r | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of human leukocyte antigen A*0101 in complex with the Fab of alloreactive antibody E07 | Authors: | Green, T.J., Killian Jr, J.T., Qiu, S., Macon, K.J., Yang, G., King, R.G., Lund, F.E. | Deposition date: | 2023-06-21 | Release date: | 2024-12-21 |
|
PDBID: | 8phm | Status: | HPUB -- hold until publication | Title: | Oxalate-bound cobalt(II) human carbonic anhydrase II | Authors: | Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C. | Deposition date: | 2023-06-20 | Release date: | 2024-12-20 | Sequence: | >Entity 1 NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
PDBID: | 8jsq | Status: | AUCO -- author corrections pending review | Deposition date: | 2023-06-20 |
|
PDBID: | 8phz | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-20 | Release date: | 2024-09-20 |
|
PDBID: | 8jsr | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-20 | Release date: | 2024-09-25 |
|
PDBID: | 8t7d | Status: | HPUB -- hold until publication | Title: | Crystal structure of wild type IDH1 bound to compound 1 | Authors: | Lu, J., Abeywickrema, P., Heo, M.R., Parthasarathy, G., McCoy, M., Soisson, S.M. | Deposition date: | 2023-06-20 |
|