| PDBID: | 9fy7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fyj | | Status: | HPUB -- hold until publication | | Title: | N-terminal domain of human galectin-8 in complex with an alpha-galactoside ligand | | Authors: | Adrover Forteza, J., Puric, E., Nilsson, U.J., Anderluh, M., Logan, D.T. | | Deposition date: | 2024-07-03 | | Sequence: | >Entity 1
SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSD
|
|
| PDBID: | 9fy9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fyh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Dye Type Peroxidase Aa from Streptomyces lividans by microcrystal electron diffraction (MicroED/3D ED) | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Finjallaz, A., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2024-07-03 | | Release date: | 2025-07-03 |
|
| PDBID: | 9fyk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Dye Type Peroxidase Aa from Streptomyces lividans by serial electron diffraction (SerialED) | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Finjallaz, A., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fya | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fye | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fyg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fyt | | Status: | HPUB -- hold until publication | | Title: | mAbs in complex with cobratoxin at pH 4.5 | | Authors: | Wade, J., Bohn, M.F., Laustsen, A.H., Morth, J.P. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fys | | Status: | HPUB -- hold until publication | | Title: | D11 mAbs bound to alpha-Bungarotoxin | | Authors: | Wade, J., Bohn, M.F., Laustsen, A.H., Morth, J.P. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9ime | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9imf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of di-NMPylated HEPN family toxin | | Authors: | Wang, X.X., Chen, R., Yao, J.Y. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9imi | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of UGT94BY1 in complex with UDP | | Authors: | Jiang, Z., Yuan, Y. | | Deposition date: | 2024-07-03 | | Release date: | 2025-07-03 |
|
| PDBID: | 9imh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of urea-treated empty bacteriophage T5 connector complex | | Authors: | Peng, Y.N., Liu, H.R. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9imn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a TEF30-associated intermediate PSII core dimer complex, type I, from Chlamydomonas reinhardtii | | Authors: | Wang, Y., Wang, C., Li, A., Liu, Z. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9imj | | Status: | HPUB -- hold until publication | | Title: | Bacteriophage T6 topoisomerase II ATPase domain crystal strcuture | | Authors: | Xin, Y.H., Chen, Y.T. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9imk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structural basis for concurrence of template recycling and RNA capping in SARS-CoV-2 replication/transcription | | Authors: | Yan, L.M., Rao, Z.H., Lou, Z.Y. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9iml | | Status: | HPUB -- hold until publication | | Title: | Sertraline enhances the deubiquitinase activity of USP7 by binding to its switching loop region | | Authors: | Shi, L., Xu, Z., Chen, X., Xiong, B., Zhang, N. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9imm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structural basis for concurrence of template recycling and RNA capping in SARS-CoV-2 replication/transcription | | Authors: | Yan, L.M., Rao, Z.H., Lou, Z.Y. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fyf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human Casein Kinase II subunit alpha (CK2a1) in complex with TR06772818 | | Authors: | Kraemer, A., Ong, H.W., Yang, X., Brown, J.W., Chang, E., Willson, T., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fym | | Status: | HPUB -- hold until publication | | Title: | Lacto-N-biosidase from Treponema denticola ATCC 35405 | | Authors: | Vuillemin, M., Siebenhaar, S., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-07-03 | | Sequence: | >Entity 1
GSHMQTNGTMPKRKFVIAFHASVNTDKTGKNLIKELPDLQKRGINTLFLEIGYNYQWKSDPKLYNKYVLSETVAREIAAECRRLSIDLIPEINCLGHQSWENETFALLKAYPELDETPGLYPSNKDIYCRSLCSSNEKVYTILFGLIDEITEVFSVKKIHVGLDEVFLIGEDACPLCRGKDKAELFAGAVNRLYDHCVKKRGFTMYMWGDRLIDSEDEDSGYKGEYESSCNGTYPAVDLIPKDIIICDWHYDELERYGSIPYFLNKGFRVLPTSFKGIKAVNALIDYSLLYKDNPAMLGHMYTAWDNFTNKNLSRYKPMVKTIDKLKAGN
|
|
| PDBID: | 9fyl | | Status: | HPUB -- hold until publication | | Title: | Lacto-N-biosidase from Treponema denticola ATCC 35405, HisTag bound in active site | | Authors: | Vuillemin, M., Siebenhaar, S., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-07-03 | | Sequence: | >Entity 1
MPKRKFVIAFHASVNTDKTGKNLIKELPDLQKRGINTLFLEIGYNYQWKSDPKLYNKYVLSETVAREIAAECRRLSIDLIPEINCLGHQSWENETFALLKAYPELDETPGLYPSNKDIYCRSLCSSNEKVYTILFGLIDEITEVFSVKKIHVGLDEVFLIGEDACPLCRGKDKAELFAGAVNRLYDHCVKKRGFTMYMWGDRLIDSEDEDSGYKGEYESSCNGTYPAVDLIPKDIIICDWHYDELERYGSIPYFLNKGFRVLPTSFKGIKAVNALIDYSLLYKDNPAMLGHMYTAWDNFTNKNLSRYKPMVKTIDKLKAGNLEHHHHHH
|
|
| PDBID: | 9fy8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fyc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9cip | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
