| PDBID: | 9ef8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eef | | Status: | HPUB -- hold until publication | | Title: | Human Kv1.3 mutant - G427H | | Authors: | Selvakumar, P., Swartz, K.J. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with one DILP1, asymmetric conformation | | Authors: | Bai, X.C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eed | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The Hanks-type kinase PknS from Xanthomonas citri bound to CHIR-124 | | Authors: | Lima, L.P., Alvarez-Martinez, C.E., Massirer, K.B., Counago, R.M. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eee | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of HIV-1 protease in complex with GRL-10624A inhibitor | | Authors: | Kovalevsky, A., Gerlits, O., Ghosh, A. | | Deposition date: | 2024-11-19 | | Sequence: | >Entity 1
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
| PDBID: | 9eeg | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of HIV-1 protease in complex with GRL-11124A inhibitor | | Authors: | Kovalevsky, A., Gerlits, O., Ghosh, A. | | Deposition date: | 2024-11-19 | | Sequence: | >Entity 1
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
| PDBID: | 9ef4 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with two DILP1, symmetric conformation | | Authors: | Bai, X.C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef5 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with one DILP2, asymmetric conformation | | Authors: | Bai, X.C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef9 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with three DILP5, asymmetric conformation | | Authors: | Bai, X.C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9knj | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-19 | | Release date: | 2025-11-19 |
|
| PDBID: | 9knk | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-19 | | Release date: | 2025-11-19 |
|
| PDBID: | 9knl | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-19 | | Release date: | 2025-11-19 |
|
| PDBID: | 9knu | | Status: | HPUB -- hold until publication | | Title: | Neck structure of bacteriophage Mu in contracted state | | Authors: | Liu, H.R., Zhou, J.Q. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9kni | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-19 | | Release date: | 2025-11-19 |
|
| PDBID: | 9knm | | Status: | HPUB -- hold until publication | | Title: | Atrial Natriuretic Peptide Receptor complexed with human Atrial Natriuretic Peptide determined by cryoEM | | Authors: | Ogawa, H. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9knn | | Status: | HPUB -- hold until publication | | Title: | Atrial Natriuretic Peptide Receptor complexed with DGD-ANP determined by cryoEM | | Authors: | Ogawa, H. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9kno | | Status: | HPUB -- hold until publication | | Title: | Atrial Natriuretic Peptide Receptor complexed with DRD-ANP determined by cryoEM | | Authors: | Ogawa, H. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9knr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PSI-SOD supercomplex from Chromera velia | | Authors: | Feng, Y., Amunts, A. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9knw | | Status: | HOLD -- hold until a certain date | | Title: | A membrane transporter in APO status,ph 6.8 | | Authors: | Shi, J.H., Liang, J.M., Ma, D. | | Deposition date: | 2024-11-19 | | Release date: | 2025-11-19 |
|
| PDBID: | 9knx | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-19 | | Release date: | 2025-11-19 |
|
| PDBID: | 9kny | | Status: | HOLD -- hold until a certain date | | Title: | A membrane transporter complex treated with substrate, pH 8.0 | | Authors: | Shi, J.H., Liang, J.M., Ma, D. | | Deposition date: | 2024-11-19 | | Release date: | 2025-11-19 |
|
| PDBID: | 9ko0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a novel alpha/beta hydrolase from Pyrinomonas methylaliphatogenes | | Authors: | Jian, G., Li, W.S., Wei, H.L., Li, Q., Chen, Y.Y., Wu, P., Han, X., Liu, W. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ko3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-19 |
|
