PDBID: | 9ef8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-19 |
|
PDBID: | 9eef | Status: | HPUB -- hold until publication | Title: | Human Kv1.3 mutant - G427H | Authors: | Selvakumar, P., Swartz, K.J. | Deposition date: | 2024-11-19 |
|
PDBID: | 9ef3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-19 |
|
PDBID: | 9ef1 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with one DILP1, asymmetric conformation | Authors: | Bai, X.C. | Deposition date: | 2024-11-19 |
|
PDBID: | 9ef2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-19 |
|
PDBID: | 9eed | Status: | AUTH -- processed, waiting for author review and approval | Title: | The Hanks-type kinase PknS from Xanthomonas citri bound to CHIR-124 | Authors: | Lima, L.P., Alvarez-Martinez, C.E., Massirer, K.B., Counago, R.M. | Deposition date: | 2024-11-19 |
|
PDBID: | 9eee | Status: | HPUB -- hold until publication | Title: | Room-temperature X-ray structure of HIV-1 protease in complex with GRL-10624A inhibitor | Authors: | Kovalevsky, A., Gerlits, O., Ghosh, A. | Deposition date: | 2024-11-19 | Sequence: | >Entity 1 PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
PDBID: | 9eeg | Status: | HPUB -- hold until publication | Title: | Room-temperature X-ray structure of HIV-1 protease in complex with GRL-11124A inhibitor | Authors: | Kovalevsky, A., Gerlits, O., Ghosh, A. | Deposition date: | 2024-11-19 | Sequence: | >Entity 1 PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
PDBID: | 9ef4 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with two DILP1, symmetric conformation | Authors: | Bai, X.C. | Deposition date: | 2024-11-19 |
|
PDBID: | 9ef5 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with one DILP2, asymmetric conformation | Authors: | Bai, X.C. | Deposition date: | 2024-11-19 |
|
PDBID: | 9ef9 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with three DILP5, asymmetric conformation | Authors: | Bai, X.C. | Deposition date: | 2024-11-19 |
|
PDBID: | 9knj | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-11-19 | Release date: | 2025-11-19 |
|
PDBID: | 9knk | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-11-19 | Release date: | 2025-11-19 |
|
PDBID: | 9knl | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-11-19 | Release date: | 2025-11-19 |
|
PDBID: | 9knu | Status: | HPUB -- hold until publication | Title: | Neck structure of bacteriophage Mu in contracted state | Authors: | Liu, H.R., Zhou, J.Q. | Deposition date: | 2024-11-19 |
|
PDBID: | 9kni | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-11-19 | Release date: | 2025-11-19 |
|
PDBID: | 9knm | Status: | HPUB -- hold until publication | Title: | Atrial Natriuretic Peptide Receptor complexed with human Atrial Natriuretic Peptide determined by cryoEM | Authors: | Ogawa, H. | Deposition date: | 2024-11-19 |
|
PDBID: | 9knn | Status: | HPUB -- hold until publication | Title: | Atrial Natriuretic Peptide Receptor complexed with DGD-ANP determined by cryoEM | Authors: | Ogawa, H. | Deposition date: | 2024-11-19 |
|
PDBID: | 9kno | Status: | HPUB -- hold until publication | Title: | Atrial Natriuretic Peptide Receptor complexed with DRD-ANP determined by cryoEM | Authors: | Ogawa, H. | Deposition date: | 2024-11-19 |
|
PDBID: | 9knr | Status: | AUTH -- processed, waiting for author review and approval | Title: | PSI-SOD supercomplex from Chromera velia | Authors: | Feng, Y., Amunts, A. | Deposition date: | 2024-11-19 |
|
PDBID: | 9knw | Status: | HOLD -- hold until a certain date | Title: | A membrane transporter in APO status,ph 6.8 | Authors: | Shi, J.H., Liang, J.M., Ma, D. | Deposition date: | 2024-11-19 | Release date: | 2025-11-19 |
|
PDBID: | 9knx | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-11-19 | Release date: | 2025-11-19 |
|
PDBID: | 9kny | Status: | HOLD -- hold until a certain date | Title: | A membrane transporter complex treated with substrate, pH 8.0 | Authors: | Shi, J.H., Liang, J.M., Ma, D. | Deposition date: | 2024-11-19 | Release date: | 2025-11-19 |
|
PDBID: | 9ko0 | Status: | HPUB -- hold until publication | Title: | Crystal structure of a novel alpha/beta hydrolase from Pyrinomonas methylaliphatogenes | Authors: | Jian, G., Li, W.S., Wei, H.L., Li, Q., Chen, Y.Y., Wu, P., Han, X., Liu, W. | Deposition date: | 2024-11-19 |
|
PDBID: | 9ko3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-19 |
|