| PDBID: | 9o3i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with ketolide telithromycin, mRNA, aminoacylated A-site Lys-tRNAlys, P-site fMRC-peptidyl-tRNAmet, and deacylated E-site tRNAlys at 2.80A resolution | | Authors: | Syroegin, E.A., Aleksandrova, E.V., Kruglov, A.A., Paranjpe, M.N., Svetlov, M.S., Polikanov, Y.S. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the wild-type drug-free Thermus thermophilus 70S ribosome in complex with mRNA, aminoacylated A-site Lys-tRNAlys, P-site fMRC-peptidyl-tRNAmet, and deacylated E-site tRNAlys at 2.60A resolution | | Authors: | Syroegin, E.A., Aleksandrova, E.V., Kruglov, A.A., Paranjpe, M.N., Svetlov, M.S., Polikanov, Y.S. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3k | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with macrolide erythromycin, mRNA, aminoacylated A-site Lys-tRNAlys, P-site fMAC-peptidyl-tRNAmet, and deacylated E-site tRNAlys at 2.70A resolution | | Authors: | Syroegin, E.A., Aleksandrova, E.V., Kruglov, A.A., Paranjpe, M.N., Svetlov, M.S., Polikanov, Y.S. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with macrolide erythromycin, mRNA, deacylated A-site tRNAphe, P-site fMRC-peptidyl-tRNAmet, and deacylated E-site tRNAphe at 2.75A resolution | | Authors: | Syroegin, E.A., Aleksandrova, E.V., Kruglov, A.A., Paranjpe, M.N., Svetlov, M.S., Polikanov, Y.S. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3b | | Status: | HPUB -- hold until publication | | Title: | PKM2 bound to MCTI-566 | | Authors: | Stuckey, J.A. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3q | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3m | | Status: | HPUB -- hold until publication | | Title: | K40F mutant of hCRBPII bound to fentanyl | | Authors: | Bingham, C., Geiger, J.H. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
TRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTFVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK
|
|
| PDBID: | 9o3p | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qt4 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of Arabidopsis TIR-NLR WRR4A tetramer in complex with effector CCG40 (focused refinement) | | Authors: | Zhao, H., Lukoyanova, N., Selvaraj, M., Jones, J. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an NtA622L variant in complex with NADP+ and Nicotinic acid | | Authors: | Mokos, D., Daniel, B. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsv | | Status: | HPUB -- hold until publication | | Title: | Protein Kinase CK2 and bivalent inhibitors | | Authors: | Krimm, I., Gelin, M., Guichou, J.F., Grenier, D. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
MHHHHHHSSGVDLGTENLYFQSMSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSS
|
|
| PDBID: | 9qsr | | Status: | HPUB -- hold until publication | | Title: | Protein Kinase CK2 and bivalent inhibitors | | Authors: | Krimm, I., Gelin, M., Guichou, J.F., Grenier, D. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
MHHHHHHSSGVDLGTENLYFQSMSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSS
|
|
| PDBID: | 9qt0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qt1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qt2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qss | | Status: | HPUB -- hold until publication | | Title: | Protein Kinase CK2 and bivalent inhibitors | | Authors: | Krimm, I., Gelin, M., Guichou, J.F., Grenier, D. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qst | | Status: | HPUB -- hold until publication | | Title: | Protein Kinase CK2 and bivalent inhibitors | | Authors: | Krimm, I., Gelin, M., Guichou, J.F., Grenier, D. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
MHHHHHHSSGVDLGTENLYFQSMSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSS
|
|
| PDBID: | 9qsu | | Status: | HPUB -- hold until publication | | Title: | Protein Kinase CK2 and bivalent inhibitors | | Authors: | Krimm, I., Gelin, M., Guichou, J.F., Grenier, D. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
MHHHHHHSSGVDLGTENLYFQSMSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSS
|
|
| PDBID: | 9qsq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Mn(III)-substituted Wells-Dawson binding to Hen Egg-White Lysozyme (HEWL) | | Authors: | Moussawi, M.A. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qt3 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9udi | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-06 |
|
