| PDBID: | 9uj4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of human KCNQ1-CaM complex | | Authors: | Hou, P.P., Zhang, J., Cheng, X.Y., Wan, S.Y., Zhong, L., Hu, B. | | Deposition date: | 2025-04-16 | | Release date: | 2026-04-16 |
|
| PDBID: | 9uiy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-16 | | Release date: | 2026-04-16 |
|
| PDBID: | 9uiw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-16 | | Release date: | 2026-04-16 |
|
| PDBID: | 9uiu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9uit | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9o8m | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9o8q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of NI06063_d30_103 Fab in complex with influenza virus hemagglutinin from A/Hong Kong/485197/2014 (H3N2) | | Authors: | Jo, G., Ward, A.B. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9o8r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of NI06063_d30_103 Fab in complex with influenza virus hemagglutinin from A/Michigan/45/2015 (H1N1) | | Authors: | Jo, G., Ward, A.B. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9o8s | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of NI04359_d30_240 Fab in complex with influenza virus hemagglutinin from A/Hong Kong/485197/2014 (H3N2) | | Authors: | Jo, G., Ward, A.B. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9o8t | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of NI04359_d30_240 Fab in complex with influenza virus hemagglutinin from A/Michigan/45/2015 (H1N1) | | Authors: | Jo, G., Ward, A.B. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9o8w | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of an MKP5 mutant, Y435F, in complex with an allosteric inhibitor | | Authors: | Manjula, R., Bennett, A.M., Lolis, E. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9o8u | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | (1-methylalkyl)succinate synthase alpha-beta-gamma-delta complex with bound fumarate | | Authors: | Andorfer, M.C., Drennan, C.L. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9o8i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [3,8,8,P-2] Shifted tensegrity triangle with an (arm, center, arm) distribution of (3, 8, 8) base pairs, 2 nt sticky ends, and 5'' phosphates | | Authors: | Abi Rizk, J., Vecchioni, S., Horvath, A., Woloszyn, K., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9o8l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9o8k | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [6,8,5] Shifted tensegrity triangle with an (arm, center, arm) distribution of (6, 8, 5) base pairs, 2 nt sticky ends | | Authors: | Abi Rizk, J., Vecchioni, S., Horvath, A., Woloszyn, K., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9o8p | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9o8o | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9qwp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qwr | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qwv | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma cruzi enoyl-CoA hydratase | | Authors: | Brannigan, J.A., Dodson, E.J. | | Deposition date: | 2025-04-15 | | Sequence: | >Entity 1
MLRKSLFLLNSMDPIVKYAQKGAVVTLTLNRPKQLNALNAELTNALAEKLLKCDADPSVSVLIITGEGRSFVAGADIKAMANQTFVEFYKHNMLRGLDTIAAVRKPIIAAVNGFALGGGCELAMSCDIVVASEKAIFGQPEIKIGTIPGAGGTQRLTRLIGKSKAMEWILTGEQYTAEEAERAGLVSRVVRHEELLPTVSAMAEKIALNSPLAVSLAKDCINKALETTLAQGMAYEQRTFQATFATDDQKEGMAAFVEKRKPNFKNA
|
|
| PDBID: | 9qwq | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Human vault protein - committed conformation | | Authors: | Lapenta, F., Marechal, N., Durand, A., Aupic, J., Cassetta, A. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qx3 | | Status: | PROC -- to be processed | | Title: | E. coli beta-clamp in complex with designed circular peptide | | Authors: | Simonsen, S., Zhao, J., Soegaard, K., Olsen, J.G., Otterlei, M., Rogers, J.M., Kragelund, B.B. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qx8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qww | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of plant resistance protein NRC2 dimer bound to nematode effector SPRYSEC-15 | | Authors: | Selvaraj, M., Kamoun, S., Contreras, M. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qxj | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Rysto resistosome in complex with PVY coat protein | | Authors: | Zhao, H., Lukoyanova, N., Selvaraj, M., Jones, J. | | Deposition date: | 2025-04-15 |
|
