| PDBID: | 9o55 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o5b | | Status: | PROC -- to be processed | | Title: | RNase A in complex with N1-Methylpseudouridine Vanadate and decavanadates | | Authors: | Gutierrez, C.S., Lim, D.C., Silkenath, B., Kojasoy, V., Raines, R.T. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o4y | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o5c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR solution structure of recombinantly synthesized tarantula toxin GsAF2 | | Authors: | Adhikary, K., Poget, S.F., Zhuang, J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o4x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o54 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o52 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o53 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o50 | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of Thermus thermophilus SHMT in complex with tetrahydrofolate (THF) | | Authors: | Kovalevsky, A., Drago, V.N., Phillips, R.S. | | Deposition date: | 2025-04-09 | | Sequence: | >Entity 1
STLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTH(LLP)TLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPSEALREEVRRLALAHPMP
|
|
| PDBID: | 9o4z | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o5a | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o56 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o58 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Zymogen ADAM17-iRhom2 complex bound by the MEDI3622 Fab | | Authors: | Slone, C.E., Maciag, J.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o59 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9qth | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9ue6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9uec | | Status: | PROC -- to be processed | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9uel | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-08 | | Release date: | 2026-04-08 |
|
| PDBID: | 9qt6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtf | | Status: | HPUB -- hold until publication | | Title: | Simkania negevensis CE-clan virulence factor SnCE1 C256A catalytically inactive mutant | | Authors: | Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Simkania negevensis CE-clan virulence factor SnCE1 in complex with hsSUMO1 | | Authors: | Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qt8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Polyester Hydrolase Leipzig 7 (PHL7) variant R2M2-P155G | | Authors: | Useini, A., Strater, N., Kuenze, G., Sonnendecker, C. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qte | | Status: | HPUB -- hold until publication | | Title: | Simkania negevensis CE-clan virulence factor SnCE1 wildtype | | Authors: | Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtb | | Status: | HPUB -- hold until publication | | Title: | Apo form of the L-protein from Rift Valley Fever Virus (LPapo) | | Authors: | Kral, M., Das, A.R., Kotacka, T., Blahosova, A., Hodek, J., Konvalinka, J., Demo, G., Kozisek, M. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cytoplasmic 60S maturation intermediate (State D1) | | Authors: | Kargas, V., Warren, A.J. | | Deposition date: | 2025-04-08 |
|
