PDBID: | 9f5q | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-30 |
|
PDBID: | 9f5u | Status: | HPUB -- hold until publication | Title: | Crystal structure of Heme-Oxygenase from Corynebacterium diphtheriae complexed with Cobalt-porphyrine (HumO-Co(III)) | Authors: | Labidi, R.J., Faivre, B., Carpentier, P., Perard, J., Gotico, P., Li, Y., Atta, M., Fontecave, M. | Deposition date: | 2024-04-30 |
|
PDBID: | 9f5v | Status: | HPUB -- hold until publication | Title: | Crystal structure of thiol peroxidase from Helicobacter pylori (HpTx, reduced) | Authors: | Fiedler, M.K., Gong, R., Fuchs, S., Rox, K., Friedrich, V., Pfeiffer, D., Reinhardt, T., Mibus, C., Huber, M., Hess, C., Mejias-Luque, R., Gerhard, M., Groll, M., Sieber, S.A. | Deposition date: | 2024-04-30 | Sequence: | >Entity 1 MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQICGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK
|
|
PDBID: | 9f64 | Status: | HPUB -- hold until publication | Title: | Crystal structure of thiol peroxidase mutant (C94A) in complex with Metro* (H. pylori | Authors: | Fiedler, M.K., Gong, R., Fuchs, S., Rox, K., Friedrich, V., Pfeiffer, D., Reinhardt, T., Mibus, C., Huber, M., Hess, C., Mejias-Luque, R., Gerhard, M., Groll, M., Sieber, S.A. | Deposition date: | 2024-04-30 | Sequence: | >Entity 1 MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQIAGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK
|
|
PDBID: | 9f65 | Status: | HPUB -- hold until publication | Title: | Crystal structure of thiol peroxidase mutant (C94A) in complex with Metro-P3* (H. pylori) | Authors: | Fiedler, M.K., Gong, R., Fuchs, S., Rox, K., Friedrich, V., Pfeiffer, D., Reinhardt, T., Mibus, C., Huber, M., Hess, C., Mejias-Luque, R., Gerhard, M., Groll, M., Sieber, S.A. | Deposition date: | 2024-04-30 | Sequence: | >Entity 1 MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQIAGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK
|
|
PDBID: | 9f66 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Heme-Oxygenase from Corynebacterium diphtheriae complexed with Cobalt-porphyrine (HumO-Co(III)) flash-cooled under CO2 pressure | Authors: | Labidi, R.J., Faivre, B., Carpentier, P., Perard, J., Gotico, P., Li, Y., Atta, M., Fontecave, M. | Deposition date: | 2024-04-30 |
|
PDBID: | 9f69 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-30 | Sequence: | >Entity 1 RKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ
|
|
PDBID: | 9f6b | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human neuropilin-1 in a complex with a quinoline based antagonists | Authors: | Djordjevic, S., Selwood, D., Hubbard, P., Leonard, P., Mota, F. | Deposition date: | 2024-04-30 |
|
PDBID: | 8zcj | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of the pasireotide-bound SSTR5-Gi complex | Authors: | Li, Y.G., Meng, X.Y., Yang, X.R., Ling, S.L., Shi, P., Tian, C.L., Yang, F. | Deposition date: | 2024-04-29 |
|
PDBID: | 8zcb | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of Lysine Specific Demethylase 1 (LSD1) with JH-45 | Authors: | Zhiyan, D., Cao, D., Jiang, H., Liu, T., Xiong, B. | Deposition date: | 2024-04-29 |
|
PDBID: | 8zc9 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-29 |
|
PDBID: | 8zcf | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-29 |
|
PDBID: | 8zcd | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-29 |
|
PDBID: | 8zce | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-29 |
|
PDBID: | 8zca | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-29 |
|
PDBID: | 8zcc | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of HCoV-NL63 main protease with X77 | Authors: | Xu, J., Li, W.W., Yin, X.S., Li, J. | Deposition date: | 2024-04-29 | Release date: | 2025-04-29 |
|
PDBID: | 8zcg | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-29 |
|
PDBID: | 8zci | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-29 |
|
PDBID: | 8zch | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-29 |
|
PDBID: | 9bkk | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-29 |
|
PDBID: | 9bkj | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-29 |
|
PDBID: | 9bku | Status: | PROC -- to be processed | Deposition date: | 2024-04-29 |
|
PDBID: | 9bkr | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the Human TRIP12 WWE domain (isoform 2) in complex with ATP | Authors: | Kimani, S., Dong, A., Li, Y., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | Deposition date: | 2024-04-29 |
|
PDBID: | 9bks | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the Human TRIP12 WWE domain (isoform 2) in complex with ADP | Authors: | Kimani, S., Dong, A., Li, Y., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | Deposition date: | 2024-04-29 |
|
PDBID: | 9bl0 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-29 |
|