PDBID: | 8vx6 | Status: | HPUB -- hold until publication | Title: | Human OGG1 bound at the nucleosomal DNA entry site | Authors: | You, Q., Li, H. | Deposition date: | 2024-02-03 |
|
PDBID: | 8vx7 | Status: | HPUB -- hold until publication | Title: | Computationally designed tunable C2 symmetric tandem repeat homodimer, bound to cyclic peptide | Authors: | Kennedy, M.A., Stoddard, B.L., Said, M. | Deposition date: | 2024-02-03 |
|
PDBID: | 8vx8 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-03 |
|
PDBID: | 8y6t | Status: | HPUB -- hold until publication | Title: | Chitinase TfeC from Yersinia pseudotuberculosis | Authors: | Cui, R., Li, D.F. | Deposition date: | 2024-02-03 |
|
PDBID: | 8y6x | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-03 |
|
PDBID: | 8y70 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-03 |
|
PDBID: | 8y71 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-03 |
|
PDBID: | 8y72 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-03 |
|
PDBID: | 8y73 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-03 |
|
PDBID: | 8y6r | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-03 |
|
PDBID: | 8y6s | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-03 |
|
PDBID: | 8y6w | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-03 |
|
PDBID: | 8y6y | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-03 |
|
PDBID: | 8y6g | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rvu | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rvx | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rvy | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rvw | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw0 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the adenosine A2A receptor in complex with Istradefylline | Authors: | Glover, H. | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rwc | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rvr | Status: | HPUB -- hold until publication | Title: | Crystal structure of Trypanosoma congolense pyruvate kinase in complex with a single-domain antibody (TcoPYK-sdAb42) in the presence of sulfate | Authors: | Sterckx, Y.G.-J. | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 | Sequence: | >Entity 1 QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYPMSWVRQAPGKGLEWVSDINSSGTTYYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCATEGKYGRTWYGQLEYHYWGQGTQVTVSEHHHHHH
>Entity 2 MHHHHHHESAKAVTTQKVEVKFSKAVEKLTKEDIKVTNKANNDKVLVKEVTLSEDKKSATVELYSNLAAKQTYTVDVNKVGKTEVAVGSLEAKTIEMADQTVVADEPTALQFTVKDENGTEVVSPEGIEFVTPAAEKINAKGEITLAKGTSTTVKAVYKKDGKVVAESKEVKVSAE
|
|
PDBID: | 8rvz | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|