| PDBID: | 8vx6 | | Status: | HPUB -- hold until publication | | Title: | Human OGG1 bound at the nucleosomal DNA entry site | | Authors: | You, Q., Li, H. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8vx7 | | Status: | HPUB -- hold until publication | | Title: | Computationally designed tunable C2 symmetric tandem repeat homodimer, bound to cyclic peptide | | Authors: | Kennedy, M.A., Stoddard, B.L., Said, M. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8vx8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8y6t | | Status: | HPUB -- hold until publication | | Title: | Chitinase TfeC from Yersinia pseudotuberculosis | | Authors: | Cui, R., Li, D.F. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8y6x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8y70 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8y71 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8y72 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8y73 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8y6r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8y6s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8y6w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8y6y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8y6g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rvu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rvx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rvy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rvw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rw0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the adenosine A2A receptor in complex with Istradefylline | | Authors: | Glover, H. | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rw4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rw7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rvr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Trypanosoma congolense pyruvate kinase in complex with a single-domain antibody (TcoPYK-sdAb42) in the presence of sulfate | | Authors: | Sterckx, Y.G.-J. | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rw9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 | | Sequence: | >Entity 1
QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYPMSWVRQAPGKGLEWVSDINSSGTTYYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCATEGKYGRTWYGQLEYHYWGQGTQVTVSEHHHHHH
>Entity 2
MHHHHHHESAKAVTTQKVEVKFSKAVEKLTKEDIKVTNKANNDKVLVKEVTLSEDKKSATVELYSNLAAKQTYTVDVNKVGKTEVAVGSLEAKTIEMADQTVVADEPTALQFTVKDENGTEVVSPEGIEFVTPAAEKINAKGEITLAKGTSTTVKAVYKKDGKVVAESKEVKVSAE
|
|
| PDBID: | 8rvz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
