| PDBID: | 9ezl | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trehalose synthase mutant N253H from Deinococcus radiodurans | | Authors: | Ye, L.C., Chen, S.C. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 8z1p | | Status: | PROC -- to be processed | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1k | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | P ring on polyrod-P ring complex from Salmonella typhimurium HK26292 mutant | | Authors: | Yamaguchi, T., Kato, T., Minamino, T., Namba, K. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of SARS main protease in complex with PF-00835231 | | Authors: | Lin, C., Zhang, J., Li, J. | | Deposition date: | 2024-04-11 | | Release date: | 2025-04-11 |
|
| PDBID: | 8z1q | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of human ELAC2-pre-tRNA | | Authors: | Liu, Z.M., Xue, C.Y. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1e | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1f | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of human ELAC2-tRNA | | Authors: | Liu, Z.M., Xue, C.Y. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the isomerase Art22 | | Authors: | Guo, L., Li, P.W., Li, D.F., Chen, Y.H. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1d | | Status: | PROC -- to be processed | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1b | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1c | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | isocitrate lyase MoMcl1 | | Authors: | Liu, X.H., Zhao, W.H. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1m | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1o | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bd6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bdb | | Status: | HPUB -- hold until publication | | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | | Authors: | Schormann, N., Green, T., Turnbough, C.L. | | Deposition date: | 2024-04-11 | | Sequence: | >Entity 1
MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2
AFDPNLVGPTLPPIPPFTL
|
|
| PDBID: | 9bda | | Status: | HPUB -- hold until publication | | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | | Authors: | Schormann, N., Green, T., Turnbough, C.L. | | Deposition date: | 2024-04-11 | | Sequence: | >Entity 1
MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2
AFDPNLVGPTLPPIPPFTL
|
|
| PDBID: | 9bdd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM Structure of Non-Cognate Substrate Bound in the Entry Site (ES) of Human Mitochondrial Transcription Elongation Complex | | Authors: | Herbine, K.H., Nayak, A.R., Temiakov, D. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bdc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM Structure of the TEFM bound Human Mitochondrial Transcription Elongation Complex in a Closed Fingers Domain Conformation | | Authors: | Herbine, K.H., Nayak, A.R., Temiakov, D. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bd4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-11 |
|
