| PDBID: | 8wlt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-01 |
|
| PDBID: | 8wlw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DelP123_Msd in complex with 5-azauracil | | Authors: | Porathoor, S., Anand, R. | | Deposition date: | 2023-10-01 |
|
| PDBID: | 8wlx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of P123A_Msd | | Authors: | Porathoor, S., Anand, R. | | Deposition date: | 2023-10-01 |
|
| PDBID: | 8qp6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Hepatitis C Virus E1 glycoprotein epitope 314-324 scaffold design 1W4K_08 in complex with neutralizing antibody F(ab) fragment IGH526 | | Authors: | Nagarathinam, K., Krey, T. | | Deposition date: | 2023-09-30 | | Sequence: | >Entity 1
MGSREVATPHRAAWLAMMLGIDASKVKGTGPGGVITVEDVKRWAEETAKATAGSENLYFQ
>Entity 2
EVQLLEQSGAEVKRPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGWINPGNGNAKYSQRFQGRVIISRDTSATTSYMELSSLTSEDTAVYSCARDRGFDLLTGHYLGLDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCGSLEDDDDKAGWSHPQFEKGGGSGGGSGGGSWSHPQFEKEIELTLTQPASASATPGQRVTISCSGSSSNIGGNTVNWYQHLPGAAPKLLIHNNDLRPSGVPDRFSGSKSGTSASLAVSGLQSEDEADYFCAAWDDGLNGWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
|
|
| PDBID: | 8qp7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Hepatitis C Virus E2 glycoprotein epitopeI 411-424 scaffold design 4CIL_04 | | Authors: | Nagarathinam, K., Cramer, J.T., Krey, T. | | Deposition date: | 2023-09-30 |
|
| PDBID: | 8uea | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-30 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGS(CSO)GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 8ueb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-30 |
|
| PDBID: | 8wlp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-30 |
|
| PDBID: | 8wln | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-30 |
|
| PDBID: | 8wlq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-30 |
|
| PDBID: | 8wli | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-30 |
|
| PDBID: | 8qp5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-29 |
|
| PDBID: | 8qoo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Sirt2 in complex with the peptide-based pseudo-inhibitor TNFn-4.1 | | Authors: | Friedrich, F., Kalbas, D., Meleshin, M., Einsle, O., Schutkowski, M., Jung, M. | | Deposition date: | 2023-09-29 |
|
| PDBID: | 8qol | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-29 | | Release date: | 2024-09-29 |
|
| PDBID: | 8qp1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-29 | | Release date: | 2025-03-29 |
|
| PDBID: | 8qp2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-29 | | Release date: | 2025-03-29 |
|
| PDBID: | 8qp3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-29 | | Release date: | 2025-03-29 |
|
| PDBID: | 8qp4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-29 | | Release date: | 2025-03-29 |
|
| PDBID: | 8ue4 | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with N6-Dimethyladenine | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2023-09-29 |
|
| PDBID: | 8ue5 | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with N6-Methyladenine | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2023-09-29 |
|
| PDBID: | 8ue6 | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with N6-Methyladenosine | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2023-09-29 |
|
| PDBID: | 8ue8 | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with ADP | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2023-09-29 |
|
| PDBID: | 8ue7 | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with 2''-Deoxyadenosine | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2023-09-29 |
|
| PDBID: | 8ue3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-29 |
|
| PDBID: | 8uds | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The Crystal Structure of CoxG from M. smegmatis, minus lipid anchoring C-terminus. | | Authors: | Rhys, R., Kropp, A. | | Deposition date: | 2023-09-29 |
|
