| PDBID: | 9ni2 | | Status: | HPUB -- hold until publication | | Title: | Fab369 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Hsp82-MD in complex with the CS domain of Sgt1 | | Authors: | Lopez, A., Napolitano, V., Delhommel, F., Popowicz, G.M., Sattler, M. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8r | | Status: | HPUB -- hold until publication | | Title: | Human ROCK1 in complex with a dihydropyrazolo-pyrimidine inhibitor | | Authors: | Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C. | | Deposition date: | 2025-02-25 | | Sequence: | >Entity 1
GASFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRY
|
|
| PDBID: | 9q8l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8y | | Status: | HPUB -- hold until publication | | Title: | Structure of RNF38 RING with linchpin mutant R454Y in complex with Ubch5B-Ub | | Authors: | Gabrielsen, M., Buetow, L., Huang, D.T. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8t | | Status: | HPUB -- hold until publication | | Title: | Nociceptive properties of U5-theraphotoxin-Hs1b, a novel peptide from the Cyriopagopus schmidti spider, active on NaV1.7 channel | | Authors: | Meudal, H., Landon, C. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8p | | Status: | HPUB -- hold until publication | | Title: | Structure characterization and anticancer potential of the fungal immunomodulatory protein FIP-ach | | Authors: | Wszolek, A., Patel, S.N., Dubin, G. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8u | | Status: | HPUB -- hold until publication | | Title: | Complex of Caprine Serum Albumin with Cefaclor | | Authors: | Duszynski, K., Talaj, J.A., Bujacz, A., Bujacz, G. | | Deposition date: | 2025-02-25 | | Sequence: | >Entity 1
DTHKSEIAHRFNDLGEENFQGLVLIAFSQYLQQCPFDEHVKLVKELTEFAKTCVADESHAGCDKSLHTLFGDELCKVATLRETYGDMADCCEKQEPERNECFLKHKDDSPDLPKLKPEPDTLCAEFKADEKKFWGKYLYEVARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKADFTDVTKIVTDLTKVHKECCHGDLLECADDRADLAKYICDHQDTLSSKLKECCDKPVLEKSHCIAEIDKDAVPENLPPLTADFAEDKEVCKNYQEAKDVFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEDCCAKEDPHACYATVFDKLKHLVDEPQNLIKKNCELFEKHGEYGFQNALIVRYTRKAPQVSTPTLVEISRSLGKVGTKCCAKPESERMPCTEDYLSLILNRLCVLHEKTPVSAKVTKCCTESLVNRRPCFSDLTLDETYVPKPFDGESFTFHADICTLPDTEKQIKKQTALVELLKHKPKATDEQLKTVMENFVAFVDKCCAADDKEGCFLLEGPKLVASTQAALA
|
|
| PDBID: | 9q8v | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8q | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNKK2A2 gene product) in complex with F2X-Entry screen fragment E03 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8k | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8m | | Status: | HPUB -- hold until publication | | Title: | VPS35-VPS26-SNX12 Complex | | Authors: | Pardo, M., Rojas, A.L., Hierro, A. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8z | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8w | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8s | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment A11 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8x | | Status: | HPUB -- hold until publication | | Title: | Ku70/80 bound to a 153 bp H2AX nucleosome | | Authors: | Hall, C., Chaplin, A.K. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9m0f | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-24 | | Release date: | 2026-02-24 |
|
| PDBID: | 9m0e | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9m06 | | Status: | HPUB -- hold until publication | | Title: | Outer membrane lipoprotein QseG of Salmonella enterica serovar Typhimurium SL1344 | | Authors: | Gao, X., Li, G.B., Gong, P.Q. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9m07 | | Status: | HPUB -- hold until publication | | Title: | Histidine kinase QseE sensor domain of Salmonella Typhimurium SL1344 | | Authors: | Gao, X., Li, G.B., Gong, P.Q. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9m08 | | Status: | HPUB -- hold until publication | | Title: | Structure of outer membrane lipoprotein QseG and histidine kinase QseE complex | | Authors: | Gao, X., Li, G.B., Gong, P.Q. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9m09 | | Status: | HPUB -- hold until publication | | Title: | Structure of TqaM from Penicillium aethiopicum in complex with substrate | | Authors: | Wang, H., Mori, T., Abe, I. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9m0b | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of alpha-agarase AGA from Catenovulum maritimum | | Authors: | Zhang, X.M., Li, W.H., Han, X.D. | | Deposition date: | 2025-02-24 | | Release date: | 2026-02-24 |
|
| PDBID: | 9m0a | | Status: | HPUB -- hold until publication | | Title: | Structure of TqaM from Penicillium aethiopicum in complex with D-(+)-3-phenyllactic acid | | Authors: | Wang, H., Mori, T., Abe, I. | | Deposition date: | 2025-02-24 |
|
