| PDBID: | 9erh | | Status: | HPUB -- hold until publication | | Title: | Uhgb_MS mannoside synthase from an unknown human gut bacterium in complex with 1,2-beta-mannobiose | | Authors: | Cioci, G., Ladeveze, S., Potocki-Veronese, G. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9er8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9er4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9eqw | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Human Picobirnavirus CP Reassembled VLP | | Authors: | Rodriguez-Espinosa, M.J., Novoa, G., Martinez-Romero, J.M., de Pablo, P.J., Caston, J.R. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9erd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9er5 | | Status: | HPUB -- hold until publication | | Title: | Hydrogenase-1 Ni-B state poised at +100mV | | Authors: | Carr, S.B., Li, W., Wong, K.l., Ash, P.A., Vincent, K.A. | | Deposition date: | 2024-03-22 | | Sequence: | >Entity 1
LENKPRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGTQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAAAGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIPDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAENGFWDRGSFYSRVVDIPRSHHHHHH
>Entity 2
MSTQYETQGYTINNAGRRLVVDPITRIEGHMRCEVNINDQNVITNAVSCGTMFRGLEIILQGRDPRDAWAFVERICGVCTGVHALASVYAIEDAIGIKVPDNANIIRNIMLATLWCHDHLVHFYQLAGMDWIDVLDALKADPRKTSELAQSLSSWPKSSPGYFFDVQNRLKKFVEGGQLGIFRNGYWGHPQYKLPPEANLMGFAHYLEALDFQREIVKIHAVFGGKNPHPNWIVGGMPCAINIDESGAVGAVNMERLNLVQSIITRTADFINNVMIPDALAIGQFNKPWSEIGTGLSDKCVLSYGAFPDIANDFGEKSLLMPGGAVINGDFNNVLPVDLVDPQQVQEFVDHAWYRYPNDQVGRHPFDGITDPWYNPGDVKGSDTNIQQLNEQERYSWIKAPRWRGNAMEVGPLARTLIAYHKGDAATVESVDRMMSALNLPLSGIQSTLGRILCRAHEAQWAAGKLQYFFDKLMTNLKNGNLATASTEKWEPATWPTECRGVGFTEAPRGALGHWAAIRDGKIDLYQCVVPTTWNASPRDPKGQIGAYEAALMNTKMAIPEQPLEILRTLHSFDPCLACSTH
|
|
| PDBID: | 8yrd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of hydroxylase in soluble methane monooxygenase from Methylosinus sporium 5 | | Authors: | Hwang, Y., Ryu, B., Pozharski, E., Lee, S.J. | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8yri | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of sugar phosphotransferase system EIIB component CPF_0401 from Clostridium perfringens | | Authors: | Hirayama, Y., Oiki, S., Mikami, B., Ogura, K., Hashimoto, W. | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8yrb | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8yrs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human RECQ1 helicase containing a flexible linker in complex with tailed duplex DNA | | Authors: | Das, T., Das, A.K., Ganguly, A. | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8yre | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8yrl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8yrq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8yrm | | Status: | HPUB -- hold until publication | | Title: | Iota toxin Ib pore serine-clamp mutant | | Authors: | Mitani, Y., Yoshida, T., Yamada, T., Kishikawa, J., Tsuge, H. | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8yrk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-21 |
|
| PDBID: | 9b4y | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of importin alpha-1/beta bound to TDP-43 | | Authors: | Ko, Y., Cingolani, G. | | Deposition date: | 2024-03-21 |
|
| PDBID: | 9b4p | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-03-21 |
|
| PDBID: | 9b4q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 9b4o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 9b4n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 9b4r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 9b4u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 9b4s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 9b51 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 9b50 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
