| PDBID: | 8rbk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rba | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbf | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the post-powerstroke actomyosin-5a complex | | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbb | | Status: | HPUB -- hold until publication | | Title: | p53-Y220C Core Domain Covalently Bound to 2,5,6-trifluoropyridine-3-carbonitrile Soaked at 40 mM | | Authors: | Stahlecker, J., Klett, T., Stehle, T., Boeckler, F.M. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbc | | Status: | HPUB -- hold until publication | | Title: | p53-Y220C Core Domain Covalently Bound to 3-amino-5-chloropyrazine-2,6-dicarbonitrile Soaked at 5 mM | | Authors: | Stahlecker, J., Klett, T., Stehle, T., Boeckler, F.M. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbg | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of primed myosin-5a (ADP-Pi state) | | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of chimeric human carbonic anhydrase IX with 4-chloro-2-(cyclohexylsulfanyl)-N-(2-hydroxyethyl)-5-sulfamoylbenzamide | | Authors: | Manakova, E.N., Smirnov, A., Paketuryte, V., Grazulis, S. | | Deposition date: | 2023-12-04 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8rbe | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v7s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v7p | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the truncated P1 pilin from Pseudomonas aeruginosa | | Authors: | Bragagnolo, N.J., Audette, G.F. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v7q | | Status: | HPUB -- hold until publication | | Title: | IpaD (122-321) Pi-helix Mutant (delta Q148) Apo Structure | | Authors: | Barker, S.A., Dickenson, N.E., Johnson, S.J. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v7y | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v7x | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v6w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v6x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 2 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v6y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 3 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v6z | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 4 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v70 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 6 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v71 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 7 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v72 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 8 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v73 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 9 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v74 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 10 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
