| PDBID: | 9iii | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ZIKV-117 Fab | | Authors: | Zhao, H., Deng, Z. | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9iin | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of CTF18-PCNA with ATP and Mg2+ | | Authors: | Briola, G.R., Tehseen, M., Al-Amodi, A., Nguyen, P.Q., Savva, C.G., Hamdan, S.M., De Biasio, A. | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9iij | | Status: | HPUB -- hold until publication | | Title: | Engineered LmrR with V15 replaced by unnatural amino acid 4-amino-L-phenyl-cysteine | | Authors: | Zhou, Z., Huang, W. | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9iik | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cc1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cbv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cc5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cbs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Gcn2 HisRS-like domain, Catalytic Domain, from Chaetomium thermophilum | | Authors: | Zhang, J. | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cbw | | Status: | PROC -- to be processed | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cbx | | Status: | PROC -- to be processed | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cby | | Status: | PROC -- to be processed | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cbz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cc2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cc6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cc4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cc7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cbu | | Status: | PROC -- to be processed | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9frq | | Status: | HPUB -- hold until publication | | Title: | Solution structure of Tx33.1 from Conus textile | | Authors: | Ellgaard, L., Khilji, M.S., Hackney, C.M., Teilum, K. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frk | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to SD mRNA | | Authors: | Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9fry | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9fq9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frr | | Status: | HPUB -- hold until publication | | Title: | Caspase recruitment domain (CARD) | | Authors: | Dym, O., Amitai, G., Wein, T., Sorek, R. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9fro | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pent - p-sulfonatocalix[6]arene complex | | Authors: | Flood, R.J., Crowley, P.B. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9fru | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Sirt2 in complex with a pyrazole-based fragment inhibitor and NAD+ | | Authors: | Friedrich, F., Einsle, O., Jung, M. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frm | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of glycogen phosphorylase with an indole derivative | | Authors: | Koulas, S.M., Leonidas, D.D. | | Deposition date: | 2024-06-19 | | Sequence: | >Entity 1
MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKI(CSO)GGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYVK(CSO)QERVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEKIP
|
|
