| PDBID: | 8uiy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8uiz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wpx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wph | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wpi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wpj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wpw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wpq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wpo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wpr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wps | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wpl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wpm | | Status: | HPUB -- hold until publication | | Title: | Structure of a TRP channel complex, antagonist-bound state | | Authors: | Won, J., Jeong, H., Lee, H.H. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wpn | | Status: | HPUB -- hold until publication | | Title: | Structure of a TRP channel | | Authors: | Won, J., Jeong, H., Lee, H.H. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wpy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wq3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wp7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8wpa | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qrj | | Status: | HPUB -- hold until publication | | Title: | LCC-ICCG PETase mutant H218Y | | Authors: | Orr, G., Niv, Y., Barakat, M., Boginya, A., Dessau, M., Afriat-Jurnou, L. | | Deposition date: | 2023-10-09 | | Sequence: | >Entity 1
MDGVLWRVRTAALMAALLALAAWALVWASPSVEAQSNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDGPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEADTVAPVSQYAIPFYQNLPSTTPKVYVELCNASHIAPNSNNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALCDFRTNNRHCQ
|
|
| PDBID: | 8qrs | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qru | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qrv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qrw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qri | | Status: | HPUB -- hold until publication | | Title: | TRRAP and EP400 in the human Tip60 complex | | Authors: | Li, C., Smirnova, E., Schnitzler, C., Crucifix, C., Concordet, J.P., Brion, A., Poterszman, A., SChultz, P., Papai, G., Ben-Shem, A. | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qrz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
