| PDBID: | 9glj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gll | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of UFC1 W145F | | Authors: | Kumar, M., Banerjee, S., Wiener, R. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gln | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glf | | Status: | HOLD -- hold until a certain date | | Title: | Anthraquinone Pigment Production Regulated by Cinnamic Acid | | Authors: | Su, L., Schmalhofer, M., Grammbitter, G.L.C., Paczia, N., Glatter, T., Groll, M., Bode, H.B. | | Deposition date: | 2024-08-27 | | Release date: | 2025-08-27 | | Sequence: | >Entity 1
GSSHHHHHHSGDPASMNNKNKPNRISPELLATCGYFMPRIFFLNSQYAPQVHWGDVVAALSHFPAGNLDLSSEEFWYEWMINWSKVGDSYINIANSAKSEVSHVRALRSAAACYHWAEFMYFSDRSRKIQLREYIRSCFLSSIKYSDLLVDHQYIVVDKFHMPFFLIFPKGYKEEENHPLPCVILSNGLDSMTEIEILSLAEFFLGKNMAVAIFDGPGQGINLGKSPIAIDMELYVSSIVKLLEDDARINSNLLCFLGISFGGYFALRVAQRIGDKFCCIVNLSGGPEIAEFDKLPRRLKEDFQFAFMQDNSHMQSIFDEIKLDISLPCKTKVFTVHGELDDIFQIDKVKKLDQLWGDNHQLLCYESEAHVCLNKINEYMIQVSDWVSEQFWLNGYKKG
|
|
| PDBID: | 9gl5 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of the Thermus thermophilus Q190E mutant of the PilF-GSPIIB domain in the c-di-GMP bound state | | Authors: | Neissner, K., Woehnert, J. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glg | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | X-ray structure of the Thermus thermophilus Q218E mutant of the PilF-GSPIIB domain in the c-di-GMP bound state | | Authors: | Neissner, K., Woehnert, J. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gld | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of p73 tetramerisation domain in complex with darpins 1800 | | Authors: | Chaikuad, A., Strubel, A., Doetsch, V., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gla | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbe | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbp | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human SOD1 (C6A/C111A) amyloid filament | | Authors: | Baek, Y., Kim, H., Lee, D., Kim, D., Jo, E., Roh, S.-H., Ha, N.-C. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbu | | Status: | HPUB -- hold until publication | | Title: | Structure of LAT4 in complex with digitonin | | Authors: | Yin, Y.X., Ding, D., Lu, Y.S., Chen, H.Y. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbo | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human SOD1 (WT) amyloid filament | | Authors: | Baek, Y., Kim, H., Lee, D., Kim, D., Jo, E., Roh, S.-H., Ha, N.-C. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
