| PDBID: | 8whe | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whg | | Status: | HPUB -- hold until publication | | Title: | imine reductase mutant - M3 | | Authors: | Zhu, X.X., Chen, X.R., Zheng, G.W. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8who | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH20541 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH201042 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH21398 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-23 | | Sequence: | >Entity 1
GSHMVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGNMVHASYLLTSGDLRFLFTAPYSPSLSAGEIKPTTTASIPSFDHGSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAIPSSPPIVLNEAVTIAEVKLYGDVVLRYVSYKAEDTEKSEFLPGFERVEDASSFPLDYGIRRLDHAVGNVPELGPALTYVAGFTGFHQFAEFTADDVGTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFRTLREMRKRSSIGGFDFMPSPPPTYYQNLKKRVGDVLSDDQIKECEELGILVDRDDQGTLLQIFTKPLGDRPTIFIEIIQRVGCMMKDEEGKAYQSGGCGGFGKGNFSELFKSIEEYEKTLEAKQLVG
|
|
| PDBID: | 8qmd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 | | Release date: | 2025-03-22 |
|
| PDBID: | 8qmj | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of Paradendryphiella salina PL7C alginate lyase mutant H124 soaked with hexa-mannuronic acid | | Authors: | Wilkens, C. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ub7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 | | Release date: | 2025-03-22 |
|
| PDBID: | 8ub8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ub9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ubb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ubc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ubf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8uav | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ub4 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cdc48-Shp1 unfolding native substrate, consensus structure | | Authors: | Cooney, I., Schubert, H.L., Cedeno, K., Carson, R., Fisher, O.N., Price, J.C., Hill, C.P., Shen, P.S. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ub0 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of Histidine-5''-O-adenosine phosphoramidate/RNase A | | Authors: | Pallan, P.S., Egli, M. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ub2 | | Status: | HPUB -- hold until publication | | Title: | Structure of Adenosine monophosphate/RNase A | | Authors: | Pallan, P.S., Egli, M. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ub1 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of Butyl-5''-O-adenosine phosphoramidate/RNase A | | Authors: | Pallan, P.S., Egli, M. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8uaz | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of Glutamyl-5''-O-adenosine phosphoramidate/RNase A | | Authors: | Pallan, P.S., Egli, M. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8uay | | Status: | HPUB -- hold until publication | | Title: | Structure of Arginyl-5''-O-adenosine phosphoramidate/RNase A | | Authors: | Pallan, P.S., Egli, M. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8uax | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of Alanyl-5''-O-adenosine phosphoramidate/RNase A | | Authors: | Pallan, P.S., Egli, M. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8uaw | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of Brucella Abortus Lumazine Synthase (BLS) Engineered with Shiga Toxin II subunit B (Stx2B) | | Authors: | Cristofalo, A.E., Sharma, A., Cerutti, M.L., Sharma, K., Zylberman, V., Goldbaum, F.A., Borgnia, M.J., Otero, L.H. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8uba | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ubd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
