| PDBID: | 8x3o | | Status: | HOLD -- hold until a certain date | | Title: | Structure of Cyclic Rev | | Authors: | Kim, D., Lim, Y., Barnwal, R.P. | | Deposition date: | 2023-11-14 | | Release date: | 2024-11-14 |
|
| PDBID: | 8x3m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of p38alpha with an allosteric inhibitor 2 | | Authors: | Hasegawa, S., Kinoshita, T. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8x3q | | Status: | HPUB -- hold until publication | | Title: | tll1591 with alpha-glucan 4sugar | | Authors: | Su, J.Y. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8x3p | | Status: | HOLD -- hold until a certain date | | Title: | Structure of linear Rev | | Authors: | Kim, D., Lim, Y., Barnwal, R.P. | | Deposition date: | 2023-11-14 | | Release date: | 2024-11-14 |
|
| PDBID: | 8x3u | | Status: | HPUB -- hold until publication | | Title: | tll1591 with alpha_glucan 3sugar | | Authors: | Su, J.Y. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8r44 | | Status: | HPUB -- hold until publication | | Title: | PAS-GAF bidomain of Glycine max phytochrome A | | Authors: | Guan, K., Nagano, S., Hughes, J. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8r45 | | Status: | HPUB -- hold until publication | | Title: | Phytochromobilin-adducted PAS-GAF bidomain of Glycine max phytochrome A | | Authors: | Guan, K., Chen, P., Nagano, S., Hughes, J. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8r4a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8r4f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the native copper efflux oxidase (CueO) from Hafnia alvei | | Authors: | Leone, P., Contaldo, U. | | Deposition date: | 2023-11-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 8r4k | | Status: | HPUB -- hold until publication | | Title: | Plastidial phosphorylase Pho1 trimer from Solanum tuberosum | | Authors: | Koulas, S.M., Leonidas, D.D. | | Deposition date: | 2023-11-13 | | Sequence: | >Entity 1
TLSEKIHHPITEQGGESDLSSFAPDAASITSSIKYHAEFTPVFSPERFELPKAFFATAQSVRDSLLINWNATYDIYEKLNMKQAYYLSMEFLQGRALLNAIGNLELTGAFAEALKNLGHNLENVASQEPDAALGNGGLGRLASCFLDSLATLNYPAWGYGLRYKYGLFKQRITKDGQEEVAEDWLEIGSPWEVVRNDVSYPIKFYGKVSTGSDGKRYWIGGEDIKAVAYDVPIPGYKTRTTISLRLWSTQVPSADFDLSAFNAGEHTKACEAQANAEKICYILYPGDESEEGKILRLKQQYTLCSASLQDIISRFERRSGDRIKWEEFPEKVAVQMNDTHPTLCIPELMRILIDLKGLNWNEAWNITQRTVAYTNHTVLPEALEKWSYELMQKLLPRHVEIIEAIDEELVHEIVLKYGSMDLNKLEEKLTTMRILENFDLPSSVAELFIKPEISVDDDTETVEVHDKVEASDKVVTNDEDDTGKKTSVKIEAAAEKDIDKKTPVSPEPAVIPPKKVRMANLCVVGGHAVNGVAEIHSEIVKEEVFNDFYELWPEKFQNKTNGVTPRRWIRFCNPPLSAIITKWTGTEDWVLKTEKLAELQKFADNEDLQNEWREAKRSNKIKVVSFLKEKTGYSVVPDAMFDIQVKRIHEYKRQLLNIFGIVYRYKKMKEMTAAERKTNFVPRVCIFGGKAFATYVQAKRIVKFITDVGATINHDPEIGDLLKVVFVPDYNVSVAELLIPASDLSEHISTAGMEASGTSNM(LLP)FAMNGCIQIGTLDGANVEIREEVGEENFFLFGAQAHEIAGLRKERADGKFVPDERFEEVKEFVRSGAFGSYNYDDLIGSLEGNEGFGRADYFLVGKDFPSYIECQEKVDEAYRDQKRWTTMSILNTAGSYKFSSDRTIHEYAKDIWNIEAVEIA
|
|
| PDBID: | 8r4h | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the copper efflux oxidase (CueO) from Hafnia alvei deleted of the Met-rich domain | | Authors: | Leone, P., Contaldo, U. | | Deposition date: | 2023-11-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 8uy7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uy9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uya | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uy8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uyc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uyq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Consensus olfactory receptor consOR4 bound to 2-methylthiazoline and in complex with mini-Gs trimeric protein | | Authors: | Billesboelle, C.B., Del Torrent, C.L., Manglik, A. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uy5 | | Status: | HPUB -- hold until publication | | Title: | [ZP] Self-assembling DNA crystal with expanded genetic code using C,A,T,G, Z and P nucleotides | | Authors: | Vecchioni, S., Sha, R., Ohayon, Y.P., Hernandez, C. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uyb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8x3i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8x3d | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8x3f | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8x3k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8x3b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8x3c | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
