| PDBID: | 8kf1 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of AV-45 bound type1 amyloid beta 42 fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8kf3 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of type3 amyloid beta 42 fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8kf6 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of AV-45 bound type3 amyloid beta 42 fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8kf4 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of type1 amyloid beta 42 fibril in AD2 patient. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8kf5 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of type1 amyloid beta 42 fibril in AD3. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8kfl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8kfh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8kfi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8kfj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8q6v | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-15 | | Release date: | 2024-08-15 |
|
| PDBID: | 8kfk | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Imine Reductase from Paenibacillus mucilaginosus | | Authors: | Wu, K. | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8tts | | Status: | HPUB -- hold until publication | | Title: | OXA-48 in complex with CDD-2201 | | Authors: | Park, S., Su, L., Taylor, D., Sun, Z., Ramana, S., Chamakuri, S., Qin, X., Tan, Z., Sharma, K., Li, F., Fan, J., Hu, L., Sankaran, B., Prasad, B.V.V., Matzuk, M., Palzkill, T. | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8ttt | | Status: | HOLD -- hold until a certain date | | Title: | Structure of SNX27 FERM complexed with Fam21A repeat 15 (1124-1140) | | Authors: | Guo, Q., Chen, K.-E., Collins, B.M. | | Deposition date: | 2023-08-15 | | Release date: | 2024-08-15 |
|
| PDBID: | 8ttu | | Status: | HOLD -- hold until a certain date | | Title: | Structure of SNX27 FERM complexed with Fam21A repeat 19 (1261 - 1274) | | Authors: | Guo, Q., Chen, K.-E., Collins, B.M. | | Deposition date: | 2023-08-15 | | Release date: | 2024-08-15 |
|
| PDBID: | 8ttv | | Status: | HOLD -- hold until a certain date | | Title: | Structure of SNX27 FERM complexed with Fam21A repeat 20 (1289-1302) | | Authors: | Guo, Q., Chen, K.-E., Collins, B.M. | | Deposition date: | 2023-08-15 | | Release date: | 2024-08-15 |
|
| PDBID: | 8tu8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8tu7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8ttx | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-15 | | Release date: | 2024-08-15 |
|
| PDBID: | 8q6q | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-14 |
|
| PDBID: | 8q6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-14 |
|
| PDBID: | 8q6r | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-14 | | Release date: | 2024-08-14 |
|
| PDBID: | 8kex | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-14 | | Release date: | 2025-02-14 |
|
| PDBID: | 8ttq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-14 |
|
| PDBID: | 8ttr | | Status: | HPUB -- hold until publication | | Title: | CA9 mimic bound to SH7 | | Authors: | Peat, T.S. | | Deposition date: | 2023-08-14 |
|
| PDBID: | 8q6l | | Status: | HPUB -- hold until publication | | Title: | human Carbonic Anhydrase I in complex with 3,4-dihydro-1H-benzo[c][1,2]oxaborinin-1-ol | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-08-13 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
