PDBID: | 8rmt | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vk5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vk6 | Status: | HPUB -- hold until publication | Title: | Amide-linked, extended 14alpha-demethylase (CYP51) with antifungal azole inhibitor | Authors: | Tyndall, J.D.A., Monk, B.C., Simons, C. | Deposition date: | 2024-01-08 |
|
PDBID: | 8vk8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vk9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vjz | Status: | HPUB -- hold until publication | Title: | HLA-A*03:01 with WT KRAS-10mer | Authors: | Sim, M.J.W., Sun, P.D. | Deposition date: | 2024-01-08 |
|
PDBID: | 8vk0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vjt | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vk7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8xs2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 | Sequence: | >Entity 1 MATGQVKLQQSGAEFVKAGASVKLSCKTSGYTFNNYWIHWVKQSPGQGLEWIGEIDPSDGYSNYNQKFKGKATLTVDKSSSTAYMHLNSLTSEDSAVYYCTSSTSVGGSWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSASAAHHHHHHGAAEQKLISEEDLNGAA
>Entity 2 MSDIELTQSPLSLPVSLGDQASISCTSSQSLLHSNGDTYLHWYLQKPGQSPKLLIYTLSNRFSGVPDRFSGSGSGTDFTLKISRVEAADLGIYFCSQTTHVPYTFGGGTKLEIKRADAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEGGGSDYKDDDDK
|
|
PDBID: | 8xs1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8xrq | Status: | HPUB -- hold until publication | Title: | SARS-CoV-2 BA.1 spike RBD in complex bound with VacBB-639 | Authors: | Liu, C.C., Ju, B., Zhang, Z. | Deposition date: | 2024-01-08 |
|
PDBID: | 8xrr | Status: | HPUB -- hold until publication | Title: | A complex structure of PDGFRA with an inhibitor RH140 | Authors: | Zhu, S.J., Bi, S.Z. | Deposition date: | 2024-01-08 |
|
PDBID: | 8xrs | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8xrw | Status: | HOLD -- hold until a certain date | Title: | crystal structure of HpPPAT in complex with ATP | Authors: | Yin, H.S. | Deposition date: | 2024-01-08 | Release date: | 2025-01-08 |
|
PDBID: | 8vjq | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8vjl | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8vjm | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8xrl | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8xrm | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8xrj | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8xrn | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8xrk | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8xro | Status: | HOLD -- hold until a certain date | Title: | Crystal Structure of 5-Aminoimidazole Ribonucleotide (AIR) Synthetase from Pyrococcus horikoshii with ATP | Authors: | Chen, Y.H., Chen, C.J. | Deposition date: | 2024-01-07 | Release date: | 2025-01-07 |
|
PDBID: | 8rmh | Status: | HPUB -- hold until publication | Title: | Crystal structure of parallel G-quadruplex containing T-tetrads and TG-octaplet | Authors: | Abdullrahman, A., El Omari, K., Paterson, N., Orr, C., Lambert, M., Cardin, C.J., Sanchez-Weatherby, J., Hall, J.P. | Deposition date: | 2024-01-06 |
|