| PDBID: | 9cto | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Full length EcPKS2 - acylated dataset with three ACP positions | | Authors: | Schubert, H.L., Hill, C.P. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cu0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cu2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cty | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cu6 | | Status: | HPUB -- hold until publication | | Title: | LJF-034 Fab in complex with HIV Env JRFL NFL TD CC3+ trimer and 35O22 Fab | | Authors: | Ozorowski, G., Ward, A.B. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9ctp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cu1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9ctz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cu7 | | Status: | HPUB -- hold until publication | | Title: | Structure of 16.ND.92 Fab in complex with A/Solomon Islands/3/2006(H1N1) influenza virus Hemagglutinin | | Authors: | Ouyang, W.O., Pholcharee, T., Wu, N.C. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cte | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-07-25 | | Release date: | 2025-07-25 |
|
| PDBID: | 9g97 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g8y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g8t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the persulfide dioxygenase (PDO - PA2915) from Pseudomonas aeruginosa | | Authors: | Troilo, F., Giordano, F., Giuffre, A., Giardina, G., Di Matteo, A. | | Deposition date: | 2024-07-24 | | Sequence: | >Entity 1
MLKPDITAFFDPATSTYSYVVRDPSSRACAIVDPVLDYDPAAGRTSHASAERLIAHVRQHDLQVEWLLETHVHADHLSAAIFLQRELGGCLAIGARITQVQAKFSGLFNLGEAFPVDGRQFEHLFEDGESFRIGALECRALHTPGHTPACMTYLVGDSAFVGDTLFMPDYGTARCDFPGGDARQLYRSIQRLFALPDATRLFMCHDYTAPGRDEHRCETSVGEQRRHNVHVREGVDEEAFVAMRQQRDATLGMPTLMLPAIQVNMRGGNLPPVEGNGVRYLKIPLDLFLEHHHHHH
|
|
| PDBID: | 9g8v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g99 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Joint neutron and x-ray structure of alginate lyase PsAlg7C soaked with pentamannuronic acid | | Authors: | Wilkens, C., Meilleur, F., Morth, J.P. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g98 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Joint neutron structure of alginate lyase PsAlg7C soaked with pentamannuronic acid | | Authors: | Wilkens, C., Meilleur, F., Morth, J.P. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g8u | | Status: | HPUB -- hold until publication | | Title: | Structure of the LipA:LipB complex from Acinetobacter baumannii | | Authors: | de Oliveira Silva, Y.R., Contreras-Martel, C., Rodrigues de Melo, R., Zanphorlin, L., Trindade, D.M., Dessen, A. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g93 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoET structure of the in vitro grown Bacillus anthracis Sap S-layer | | Authors: | Sogues, A., Leigh, K., Van der Verren, S., Kudryashev, M., Pak, A., Halingstad, E.V., Cecil, A.J., Fioravanti, A., Remaut, H. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g95 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g92 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thioredoxin reductase from Cryptosporidium parvum in the ""in"" conformation | | Authors: | Gabriele, F., Palerma, M., Ardini, M., Bogard, J., Chen, X.M., Williams, D.L., Angelucci, F. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g90 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g8z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g8x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g8w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
