| PDBID: | 9gck | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gcw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gcm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gcp | | Status: | HPUB -- hold until publication | | Title: | ChREBP/14-3-3 complex stabilized by AMP | | Authors: | Moschref, M., Heimhalt, M., Pysik, T., Menzer, W.M., Basquin, J., Margulies, C.E., Ladurner, A.G. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyv | | Status: | HPUB -- hold until publication | | Title: | Structure of the Thermococcus sibiricus NfnABC complex | | Authors: | Xiao, X., Li, H. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyw | | Status: | HPUB -- hold until publication | | Title: | Structure of the NAD(H)-bound Thermococcus sibiricus NfnABC complex | | Authors: | Xiao, X., Li, H. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cye | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 | | Sequence: | >Entity 1
GSGSMELRSITVESWDNPAASAAYGWEVFTDKDTQQAQGAQPQAYQPVAQNAQSLREVKLIAGKPGDIKNVDAGTAKVLGVKFQFTYPGDNSVTIRPPRVPEYEVLRTKSYLDANNQRKVSKIYGVEFPGVSKAISVWV(YCM)GRGNEYNLEGWIEDWKGDTHILQFGSLDFIGWRPLTVGIPQGVPQDVNSYPQVKTIVFKQFKIRSRPDTSGETVYLFFDELRVLSDVFEVHFDGASIDFDDEDCKSKHKLDKMLKTK
|
|
| PDBID: | 9cyt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j0o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j0p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j09 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j0t | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-08-02 | | Release date: | 2025-08-02 |
|
| PDBID: | 9j0l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j0m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j0r | | Status: | HPUB -- hold until publication | | Title: | Structure of pcStar in the green fluorescent state | | Authors: | Zheng, S.P. | | Deposition date: | 2024-08-02 |
|
