| PDBID: | 9d8x | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Human Enterovirus D94 empty particle | | Authors: | Fu, J., Klose, T., Rossmann, M.R., Kuhn, R., Center for Structural Genomics of Infectious Diseases (CSGID) | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9d92 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9d8t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KPC-2 complexed with compound 15 | | Authors: | Jacobs, L.M.C., Chen, Y. | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9d8z | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ACVR1 (ALK2) Kinase Domain in complex with inhibitor CDD-2282 | | Authors: | Ta, H.M., Kim, C., Jimmidi, R., Matzuk, M.M. | | Deposition date: | 2024-08-20 | | Sequence: | >Entity 1
STLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC
|
|
| PDBID: | 9d8r | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9d90 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of partially open HIV-1 BG505 SOSIP.664 Env bound to 3-sCD4, 3-17b Fab and 3-VRC34.01 Fab | | Authors: | Thakur, B., Acharya, P. | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9d8v | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the BG505 SOSIPv2 | | Authors: | DeLaitsch, A.T., Bjorkman, P.J. | | Deposition date: | 2024-08-20 | | Release date: | 2025-02-26 |
|
| PDBID: | 9d8y | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of HIV-1 BG505 SOSIP.664 Env bound to 3-sCD4, 3-VRC34.01 Fab with one gp120 rotated | | Authors: | Thakur, B., Acharya, P. | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9d8u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9j85 | | Status: | HPUB -- hold until publication | | Title: | The complex structure of okaE with a-ketoglutarate | | Authors: | Liu, T.H., Yan, W.P. | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9j82 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9j83 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9j7w | | Status: | HPUB -- hold until publication | | Title: | Channel Rhodospin from Klebsormidium nitens (KnChR) | | Authors: | Yuzhu, Z.W., Hiroaki, A., Tatsuki, T., Fumiya, K.S., Wataru, S., Osamu, N. | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9j7x | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of quintuple mutant C terminal fragment of Clostridium perfringens enterotoxin (C-CPEm19) | | Authors: | Aoyama, H. | | Deposition date: | 2024-08-20 | | Release date: | 2025-08-20 |
|
| PDBID: | 9j7y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9j7z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9j84 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structureal mechanism of human TRPM3 ion channel inhibition | | Authors: | Yang, T.T., Cheng, X.Y. | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9j80 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9j81 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9j87 | | Status: | HPUB -- hold until publication | | Title: | Structure of Receptor | | Authors: | Min, H., Kim, K. | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9j86 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structural basis of human TRPM3 ion channels | | Authors: | Yang, T.T., Cheng, X.Y. | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9j89 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-08-20 | | Release date: | 2025-08-20 |
|
| PDBID: | 9j8a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9d8q | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9gig | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-19 |
|
