| PDBID: | 8tqr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-08 | | Release date: | 2024-08-08 |
|
| PDBID: | 8q51 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8q4y | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8q4s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phosphoserine phosphatase (SerB) from Brucella melitensis in complex with AP4 and magnesium. | | Authors: | Scaillet, T., Wouters, J. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8kcd | | Status: | HPUB -- hold until publication | | Title: | Complex of DDM1-nucleosome(H2A.W) complex with DDM1 bound to SHL2 and SHL-2 | | Authors: | Zhang, H., Zhang, Y. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8kcj | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -N7 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8kck | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -N9 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-07 | | Sequence: | >Entity 1
GAEAAAAAAVTAELRAFRAAGGTVELEDLPVTPETLARAEAALARLPPESVAVETYTVPAPTPEAFLAALEAALARLAAEGLPAILLRVVDADGNLVGSILVAAAGPPAESAAATGRVLTIYVASSPEGLKVARGLAIETRDAGGLALAIGASGAWALAGLAGALALARRLAEAHGAPVRVVTIGDPANPTDAALAAAIRAAYAAALEHHHHHH
|
|
| PDBID: | 8kce | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8tqf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Soybean SHMT8 in complex with PLP-glycine and diglutamylated 5-formyltetrahydrofolate | | Authors: | Owuocha, L.F., Beamer, L.J. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8tqh | | Status: | HPUB -- hold until publication | | Title: | MPI68 bound to Mpro of SARS-CoV-2 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8tqj | | Status: | HPUB -- hold until publication | | Title: | MPI57 bound to Mpro of SARS-CoV-2 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8tql | | Status: | HPUB -- hold until publication | | Title: | MPI54 bound to Mpro of SARS-CoV-2 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8q4c | | Status: | AUCO -- author corrections pending review | | Title: | Human PEX5 TPR domain in complex with PEX14 KIPSWQIPV peptide | | Authors: | Emmanouilidis, L., Gaussmann, S., Sattler, M. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8kc5 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -T09 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8kc4 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -NA05 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8kc9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-06 |
|
| PDBID: | 8kc8 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -T11 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8q4f | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8tq4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
| PDBID: | 8tq5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
| PDBID: | 8tq6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
| PDBID: | 8tq1 | | Status: | HPUB -- hold until publication | | Title: | HIV-1 BG505 Env SOSIP in complex with bovine Fab Bess4 and non-human primate Fab RM20A3 | | Authors: | Ozorowski, G., Lee, W.H., Ward, A.B. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8tqb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | mGluR3 in the presence of the agonist LY379268 and PAM VU6023326 | | Authors: | Strauss, A., Levitz, J. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8tq2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8tqc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-06 |
|
