PDBID: | 8trd | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8trf | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2025-02-09 |
|
PDBID: | 8tr5 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8tr6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8tr8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8q55 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-08 | Release date: | 2025-02-08 |
|
PDBID: | 8q54 | Status: | AUCO -- author corrections pending review | Title: | N5-methyl-H4MPT:CoM methyltransferase -coenzyme M complex + CoM | Authors: | Aziz, I., Vonck, J., Ermler, U. | Deposition date: | 2023-08-08 |
|
PDBID: | 8q53 | Status: | HPUB -- hold until publication | Title: | Crystal structure of truncated human Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) in apo form | Authors: | Kumar, A., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2023-08-08 |
|
PDBID: | 8q56 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-08 |
|
PDBID: | 8kcv | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of UDA01-CAAMDDFQL | Authors: | Tang, Z., Zhang, N. | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|
PDBID: | 8kcy | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2025-02-08 |
|
PDBID: | 8kco | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-08 |
|
PDBID: | 8kcr | Status: | HPUB -- hold until publication | Title: | Crystal Structure of E447A Acyl-CoA Dehydrogenase FadE15 mutant from Mycobacteria tuberculosis in complex with C18CoA | Authors: | Liu, X., Chen, R., Ma, M. | Deposition date: | 2023-08-08 |
|
PDBID: | 8kcp | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-08 |
|
PDBID: | 8kcs | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human gamma-secretase in complex with BMS906024 | Authors: | Guo, X., Li, H., Kai, U., Yan, C., Lei, J., Zhou, R., Shi, Y. | Deposition date: | 2023-08-08 |
|
PDBID: | 8kct | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human gamma-secretase in complex with Nirogacestat | Authors: | Guo, X., Li, H., Kai, U., Yan, C., Lei, J., Zhou, R., Shi, Y. | Deposition date: | 2023-08-08 |
|
PDBID: | 8kcu | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human gamma-secretase in complex with MK-0752 | Authors: | Guo, X., Li, H., Kai, U., Yan, C., Lei, J., Zhou, R., Shi, Y. | Deposition date: | 2023-08-08 |
|
PDBID: | 8kd1 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2025-02-08 |
|
PDBID: | 8q5c | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 12 (1075475) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-08-08 | Release date: | 2025-02-08 |
|
PDBID: | 8tqn | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|
PDBID: | 8tqy | Status: | HPUB -- hold until publication | Title: | X-Ray Crystal Structure of a dihydromethanopterin reductase (DmrA) from Methylobacterium extorquens AM1 in a H32 Spacegroup at 2.19 Angstrom Resolution | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbig, M., Collazo, M., Potla, P.S. | Deposition date: | 2023-08-08 | Release date: | 2025-01-08 | Sequence: | >Entity 1 MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
PDBID: | 8tqw | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-08 |
|
PDBID: | 8tqt | Status: | HPUB -- hold until publication | Title: | MPI52 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-08 |
|
PDBID: | 8tqu | Status: | HPUB -- hold until publication | Title: | MPI51 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-08 |
|
PDBID: | 8tqq | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|