| PDBID: | 8uyz | | Status: | HPUB -- hold until publication | | Title: | HBV Cp149 capsid protein (HBV dimer co-assembled with triton X-100) | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
|
|
| PDBID: | 8uz9 | | Status: | HPUB -- hold until publication | | Title: | Fundamental Characterization of Chelated and Crystallized Actinium in a Macromolecular Host | | Authors: | Rupert, P.B., Strong, R.K. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
|
|
| PDBID: | 8uyr | | Status: | HPUB -- hold until publication | | Title: | Manganese-substituted DitZ from Rhodococcus Rhodochrous | | Authors: | Liu, C., Chen, S., Rittle, J. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8uzc | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of UT14 Fab in complex with the head domain of H3 (A/Singapore/INFIMH-16-0019/2016) | | Authors: | Park, J., Georgiou, G. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8uz2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8uz3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8uyt | | Status: | HPUB -- hold until publication | | Title: | HBV T=4 capsid from HEK-293T cells | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRG
|
|
| PDBID: | 8x3y | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-14 | | Release date: | 2024-11-14 |
|
| PDBID: | 8x3z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8x3o | | Status: | HOLD -- hold until a certain date | | Title: | Structure of Cyclic Rev | | Authors: | Kim, D., Lim, Y., Barnwal, R.P. | | Deposition date: | 2023-11-14 | | Release date: | 2024-11-14 |
|
| PDBID: | 8x3m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of p38alpha with an allosteric inhibitor 2 | | Authors: | Hasegawa, S., Kinoshita, T. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8x3q | | Status: | HPUB -- hold until publication | | Title: | tll1591 with alpha-glucan 4sugar | | Authors: | Su, J.Y. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8x3p | | Status: | HOLD -- hold until a certain date | | Title: | Structure of linear Rev | | Authors: | Kim, D., Lim, Y., Barnwal, R.P. | | Deposition date: | 2023-11-14 | | Release date: | 2024-11-14 |
|
| PDBID: | 8x3u | | Status: | HPUB -- hold until publication | | Title: | tll1591 with alpha_glucan 3sugar | | Authors: | Su, J.Y. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8x3t | | Status: | HPUB -- hold until publication | | Title: | Structure of LGR4 with NB21 | | Authors: | Wang, L., Geng, Y. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8x41 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8x42 | | Status: | HPUB -- hold until publication | | Title: | Complex structure of AtHPPD with YH20195 | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8x3x | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-14 | | Release date: | 2024-11-14 |
|
| PDBID: | 8x3g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8x3i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8x3b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8x3c | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8x3d | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8r44 | | Status: | HPUB -- hold until publication | | Title: | PAS-GAF bidomain of Glycine max phytochrome A | | Authors: | Guan, K., Nagano, S., Hughes, J. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8r45 | | Status: | HPUB -- hold until publication | | Title: | Phytochromobilin-adducted PAS-GAF bidomain of Glycine max phytochrome A | | Authors: | Guan, K., Chen, P., Nagano, S., Hughes, J. | | Deposition date: | 2023-11-13 |
|
