| PDBID: | 8v1n | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of tau filaments made from jR2R3-P301L peptides induced with heparin | | Authors: | Vigers, M., Han, S. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8v18 | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoguanine with bound AMPCPP | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8v1g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8x67 | | Status: | HPUB -- hold until publication | | Title: | solution structure of Pru p 7 | | Authors: | Zheng, J., Aizawa, T., Kumeta, H. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
GSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPKCP
|
|
| PDBID: | 8x60 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8x65 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of X11P(P71T) xylanase from a metagenome derived gene from sugarcane bagasse collection site | | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MAQQCITSSQTGNHGGYFYSFWTDGGGSVSFCLQNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
| PDBID: | 8x66 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of triple mutant X11P(P71T+N13F+Q34L) xylanase from a metagenome derived gene from sugarcane bagasse collection site | | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MAQQCITSSQTGFHGGYFYSFWTDGGGSVSFCLLNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
| PDBID: | 8v12 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-19 |
|
| PDBID: | 8v13 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Black mamba toxin in complex with Centi-SNX-B03 antibody | | Authors: | Pletnev, S., Glanville, J., Kwong, P.D. | | Deposition date: | 2023-11-19 |
|
| PDBID: | 8v16 | | Status: | HPUB -- hold until publication | | Title: | Esterase with a monomeric cooperative, hysteresis or allokairy | | Authors: | Guzzo, C.R., Vinces, T.G.C., Visnardi, A.B. | | Deposition date: | 2023-11-19 |
|
| PDBID: | 8v17 | | Status: | HPUB -- hold until publication | | Title: | HIV-CA Disulfide linked Hexamer with inhibitor bound - exploration of a benzothiazole | | Authors: | Goldstone, D.C., Walsham, L.J. | | Deposition date: | 2023-11-19 | | Sequence: | >Entity 1
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKAR
|
|
| PDBID: | 8x5t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-19 |
|
| PDBID: | 8x5u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-19 |
|
| PDBID: | 8v0z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-18 |
|
| PDBID: | 8x5s | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of shikimate kinase of Mycobacterium tuberculosis complex with shikimate-3-phosphate | | Authors: | Yadav, A.K., Madhuri, M., Saini, C., Inampudi, K.K., Ethayathulla, A.S., Kumar, M. | | Deposition date: | 2023-11-18 | | Release date: | 2024-11-18 |
|
| PDBID: | 8r5n | | Status: | HPUB -- hold until publication | | Title: | DTX1 WWE domain in complex with ATP | | Authors: | Muenzker, L., Zak, K.M., Boettcher, J. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8r5s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8r5l | | Status: | HPUB -- hold until publication | | Title: | E-selectin complexed with glycomimetic ligand BW850 | | Authors: | Jakob, R.P., Ernst, B., Maier, T. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8r5m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8r5p | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8v09 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8v0a | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the worst case of the reconstruction of the ancestral triosephosphate isomerase of the last opisthokont common ancestor obtained by maximum likelihood with PGH | | Authors: | Perez-Nino, J.A., Rodriguez-Romero, A., Guerra-Borrego, Y., Fernandez-Velasco, D.A. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8v0h | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8v0e | | Status: | HPUB -- hold until publication | | Title: | ANK repeat of MIB1 | | Authors: | Cao, R., Blacklow, S.C. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8v0d | | Status: | HPUB -- hold until publication | | Title: | Ubch5B-RING3 of MIB1 fusion structure | | Authors: | Cao, R., Blacklow, S.C. | | Deposition date: | 2023-11-17 |
|
