| PDBID: | 8zu5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of Methyl parathion hydrolase mutant A66D/I143V/I145L/Q272D/S279A/ | | Authors: | Xu, F., Fan, S. | | Deposition date: | 2024-06-07 |
|
| PDBID: | 8zu1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-06-07 | | Release date: | 2025-06-07 |
|
| PDBID: | 8ztd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-07 | | Release date: | 2025-06-07 |
|
| PDBID: | 8ztf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-07 | | Release date: | 2025-06-07 |
|
| PDBID: | 8ztp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cysteine desulfurase Sufs from Mycoplasma Pneumonia | | Authors: | Wang, W.M., Ma, D.Y., Gong, W.J., Yao, H., Liu, Y.H., Wang, H.F. | | Deposition date: | 2024-06-07 |
|
| PDBID: | 8ztq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Sufu from Mycoplasma Pneumonia | | Authors: | Wang, W.M., Ma, D.Y., Gong, W.J., Yao, H., Liu, Y.H., Wang, H.F. | | Deposition date: | 2024-06-07 |
|
| PDBID: | 8ztr | | Status: | HPUB -- hold until publication | | Title: | The dimer complex of DSR2 and tube-forming domain of phage tail tube protein | | Authors: | Zheng, J., Yang, X. | | Deposition date: | 2024-06-07 |
|
| PDBID: | 8zu0 | | Status: | HOLD -- hold until a certain date | | Title: | CryoEM structure of a tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA | | Authors: | Jiang, W.X., Cheng, X.Q., Dong, X., Ma, L.X., Xing, Q. | | Deposition date: | 2024-06-07 | | Release date: | 2025-06-07 |
|
| PDBID: | 8ztw | | Status: | HOLD -- hold until a certain date | | Title: | CryoEM structure of a GH1 family beta-glucosidase | | Authors: | Jiang, W.X., Cheng, X.Q., Ma, L.X., Cao, Z., Xing, Q. | | Deposition date: | 2024-06-07 | | Release date: | 2025-06-07 |
|
| PDBID: | 8ztz | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-06-07 | | Release date: | 2025-06-07 |
|
| PDBID: | 8zu2 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human Myt1 Kinase domain Bounded with compound 39 | | Authors: | Zhang, Z.M., Zhou, Z.Q. | | Deposition date: | 2024-06-07 |
|
| PDBID: | 8ztx | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human Myt1 Kinase domain Bounded with compound 39 | | Authors: | Zhang, Z.M., Zhou, Z.Q. | | Deposition date: | 2024-06-07 |
|
| PDBID: | 8zts | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 8ztu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-07 |
|
| PDBID: | 8ztt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c6m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c5y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c60 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c5z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c6d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of mutant NonPro1 Tautomerase Superfamily Member 8U6-S1P in complex with 3-bromopropiolate inhibitor | | Authors: | Lancaster, E.B., Hardtke, H.A., Melkonian, T.R., Venkat Ramani, M.K., Johnson Jr., W.H., Baas, B.J., Zhang, Y.J., Whitman, C.P. | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c6a | | Status: | HPUB -- hold until publication | | Title: | The CRISPR associated adenosine deaminase Cad1-CARF in the apo form | | Authors: | Majumder, P., Patel, D.J. | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c69 | | Status: | HPUB -- hold until publication | | Title: | The CRISPR associated CARF-adenosine deaminase, Cad1-CARF in the cA4 bound form | | Authors: | Majumder, P., Patel, D.J. | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c68 | | Status: | HPUB -- hold until publication | | Title: | The CRISPR associated CARF-adenosine deaminase Cad1-CARF in the cA6 bound form | | Authors: | Majumder, P., Patel, D.J. | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c6n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c65 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 | | Sequence: | >Entity 1
STLEVRSQATQDLSEYYNRPYFDLRNLSGYREGNTVTFINHYQQTDVKLEGKDKDKIKDGNNENLDVFVVREGSGRQADNNSIGGITKTNRTQHIDTVQNVNLLVSKSTGQHTTSVTSTNYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRVTMKNGDFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL
|
|
