| PDBID: | 8w8m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w8x | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of beta-MSH-MC3R-Gs_Nb35 complex | | Authors: | Chen, Q., Fu, J. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w8y | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of gamma-MSH-MC3R-Gs_Nb35 complex | | Authors: | Chen, Q., Fu, J. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w8o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w90 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-04 | | Release date: | 2024-09-04 |
|
| PDBID: | 8w91 | | Status: | HPUB -- hold until publication | | Title: | Azumapecten Farreri homopolymeric ferritin mutant - H2KE exposed to H2O2 for 3 min | | Authors: | Zhang, T., Jiao, R. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w8z | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli ferritin mutant-M52H | | Authors: | Zhao, G., Zeng, R. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w92 | | Status: | HPUB -- hold until publication | | Title: | human H ferritin with 2 Fe(II)/subunit loading | | Authors: | Zhang, T., Jiao, R. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w94 | | Status: | HPUB -- hold until publication | | Title: | Azumapecten Farreri homopolymeric ferritin (ApF) mutant-H2KE exposed to H2O2 for 2 s | | Authors: | Zhang, T., Jiao, R. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w95 | | Status: | HPUB -- hold until publication | | Title: | Azumapecten Farreri homopolymeric ferritin (ApF) mutant-H2KE exposed to H2O2 for 20 s | | Authors: | Zhang, T., Jiao, R. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w8v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w96 | | Status: | HPUB -- hold until publication | | Title: | SmChiA with diacetyl chitobiose | | Authors: | Yoshiko, T., Akihiko, N. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w97 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -PK16 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w8w | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of alpha-MSH-MC3R-Gs_Nb35 complex | | Authors: | Chen, Q., Fu, J. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8qf6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-03 |
|
| PDBID: | 8w8j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of bacterial prolyl-tRNA synthetase in complex with inhibitor PAA-19 | | Authors: | Luo, Z., Zhou, H. | | Deposition date: | 2023-09-03 |
|
| PDBID: | 8w8l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of bacterial prolyl-tRNA synthetase in complex with inhibitor PAA-38 | | Authors: | Luo, Z., Zhou, H. | | Deposition date: | 2023-09-03 |
|
| PDBID: | 8w8i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-02 | | Sequence: | >Entity 1
MKKLLIAAGSVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELTDNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRETPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQVYFGIIALHHHHHH
>Entity 2
MKKLLIAAGSEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMYWVRQAPGKGLEWVSKINTNGLITKYPDSVKGRFTISRDNAKNTLYLQMNSLRPEDTAVYYCARSPSGFNRGQGTLVTVSSHHHHHH
|
|
| PDBID: | 8w8g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human TRF1 with PinX1 | | Authors: | Lei, M., Wu, J. | | Deposition date: | 2023-09-02 |
|
| PDBID: | 8w8h | | Status: | HPUB -- hold until publication | | Title: | 2-Ketoglutarate-Dependent Dioxygenase | | Authors: | Zheng, C.N., Wei, W.Q. | | Deposition date: | 2023-09-02 |
|
| PDBID: | 8qes | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-01 |
|
| PDBID: | 8qf0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-01 |
|
| PDBID: | 8qex | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-01 |
|
| PDBID: | 8qep | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-01 |
|
| PDBID: | 8qeq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-01 |
|
