| PDBID: | 8wrf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MexL | | Authors: | Wei, Y., Wu, Z.K. | | Deposition date: | 2023-10-14 | | Sequence: | >Entity 1
GSHMDPAKREAILEAAKRLFLCNGYDGSSMEAIASEAGVSKLTVYSHFTDKETLFSEAVKAKCAEQLPALYFQLAEGAPLEKVLLNIARGFHRLINSHEAIALTRLMAAQAGQNPKLSELFFEAGPKQVIDEMERLLEQARRSGKLAFPDARHAAEHFFMLVKGCANYRLLIGCAEPLDEAEGERHVEEVVALFLRAFAAGG
|
|
| PDBID: | 8qtw | | Status: | HPUB -- hold until publication | | Title: | Structure of human butyrylcholinesterase with (3-(((2-cycloheptylethyl)(methyl)amino)methyl)-1H-indol-7-yl)(methyl)carbamoylated Ser198 | | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8qtx | | Status: | HPUB -- hold until publication | | Title: | Structure of human butyrylcholinesterase with 3-(((2-cycloheptylethyl)(methyl)amino)methyl)-N-methyl-1H-indol-7-amine | | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8qty | | Status: | HPUB -- hold until publication | | Title: | LytR LCP domain from Streptococcus dysgalactiae subs. dysgalactiae | | Authors: | Paquete-Ferreira, J., Romao, M.J., Santos-Silva, T. | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8qtv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8qtr | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of the FB-bound yeast Ceramide Synthase | | Authors: | Schaefer, J., Clausmeyer, L., Koerner, C., Moeller, A., Froehlich, F. | | Deposition date: | 2023-10-13 | | Release date: | 2024-10-13 |
|
| PDBID: | 8qtu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Sirt2 in complex with the super-slow substrate TNFn-3 and NAD+ | | Authors: | Friedrich, F., Kalbas, D., Meleshin, M., Einsle, O., Schutkowski, M., Jung, M. | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8qtz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM reconstruction of VP5*/VP8* assembly from SA11 Rotavirus Tripsinized Triple Layered Particle | | Authors: | Asensio-Cob, D., Perez-Mata, C., Gomez-Blanco, J., Vargas, J., Rodriguez, J.M., Luque, D. | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8qu0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8qu6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8uki | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of 04_A06 Fab | | Authors: | DeLaitsch, A.T., Gristick, H.B., Bjorkman, P.J. | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8ukg | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of the lasso peptide wygwalassin-A1 | | Authors: | Saad, H., Zhu, L., Harris, L.A., Shelton, K.E., Mitchell, D.A. | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8ukj | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8ukh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8ukk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8ukl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8wrc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Time-Resolved Ambient Temperature Kineto-Crystallographic Structure of Initiation Factor in Complex with Ribosome | | Authors: | DeMirci, H., Yapici, I. | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8wr7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8wrd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8wre | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8wr3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-12 |
|
| PDBID: | 8wqn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-12 |
|
| PDBID: | 8qt6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-12 |
|
| PDBID: | 8qt7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-12 |
|
| PDBID: | 8qt9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-12 |
|
