Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
Status search: 12279 results
PDBID:8qg3
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qg4
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qg5
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qg6
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qgs
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2023-09-05
PDBID:8qg7
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qg8
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qg9
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qga
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qgb
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qgc
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qgg
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qgh
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qgi
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qgj
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qgk
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qgl
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qgm
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qgn
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qgo
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qgp
Status:HPUB -- hold until publication
Deposition date:2023-09-05
Release date:2025-03-11
PDBID:8qgq
Status:HPUB -- hold until publication
Deposition date:2023-09-05
Release date:2025-03-09
PDBID:8qgv
Status:HPUB -- hold until publication
Title:Human Carbonic Anhydrase I in complex with 4-(5-acetyl-6-methyl-2-oxo-1,2,3,4-tetrahydropyrimidin-4-yl)benzenesulfonamide
Authors:Angeli, A., Ferraroni, M.
Deposition date:2023-09-05
Sequence:

>Entity 1


MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
PDBID:8qgr
Status:HPUB -- hold until publication
Deposition date:2023-09-05
PDBID:8qgd
Status:HPUB -- hold until publication
Deposition date:2023-09-05
Release date:2025-03-11

222415

PDB entries from 2024-07-10

PDB statisticsPDBj update infoContact PDBjnumon