| PDBID: | 8wz5 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 sc9-10 strain: B18537) in complex with humanized nAb 5B11 | | Authors: | Liu, L., Sun, H., Sun, Y., Zheng, Q., Li, S., Zheng, Z., Xia, N. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wz6 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021 in ternary complex with NAD and DZNep | | Authors: | Gao, Y.S., Xie, R., Chen, Y.N., Ma, J.M., Ge, H.H. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wz7 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021(I255A,T287A) in ternary complex with NAD and adenosine | | Authors: | Gao, Y.S., Xie, R., Chen, Y.N., Ma, J.M., Ge, H.H. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wz8 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021(T67A,Q69A) complex with NAD | | Authors: | Gao, Y.S., Xie, R., Chen, Y.N., Ma, J.M., Ge, H.H. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wza | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human pannexin 3 in nanodisc | | Authors: | Hang, Z., Huawei, Z., Daping, W. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wzg | | Status: | HPUB -- hold until publication | | Title: | SFX structure of an Mn-carbonyl complex immobilized in hen egg white lysozyme microcrystals, 10 ns after photoexcitation at RT. | | Authors: | Maity, B., Shoji, M., Luo, F., Nakane, T., Abe, S., Owada, S., Kang, J., Tono, K., Tanaka, R., Thuc, T.T., Kojima, M., Hishikawa, Y., Tanaka, J., Tian, J., Noya, H., Nakasuji, Y., Asanuma, A., Yao, X., Iwata, S., Shigeta, Y., Nango, E., Ueno, T. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wzc | | Status: | HPUB -- hold until publication | | Title: | NYN domain of human KHNYN complex with RNA | | Authors: | Hong, S., Choe, J. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wyj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The global map of Omicron Subvariants Spike with two antibodies | | Authors: | Yan, R.H., Wang, A.J., Yang, H.N. | | Deposition date: | 2023-10-31 | | Release date: | 2024-10-31 |
|
| PDBID: | 8wyy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8wyx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8wym | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (100 nM Ca2+, pre-open state) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8wys | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0p | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0t | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-31 | | Release date: | 2024-10-31 |
|
| PDBID: | 8r0c | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Borneoldehydrogenase ancestor N39 | | Authors: | Helmer, C.P.O., Dimos, N., Loll, B. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0h | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with (E)-3-(2-(thiophen-2-yl)vinyl)-3,4-dihydroquinoxalin-2(1H)-one and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-10-31 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8r0q | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with 6-bromo-1H-benzo[d]imidazol-2-amine and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-10-31 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8r0s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0l | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8utz | | Status: | HPUB -- hold until publication | | Title: | E3 ubiquitin-protein ligase CBL-B in complex with compound 2 | | Authors: | Gajewski, S., Clifton, M.C. | | Deposition date: | 2023-10-31 |
|
