| PDBID: | 8y7v | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of CP2c/LSF DNA-binding domain | | Authors: | Park, J., Lee, S.J., Won, H.S., Lee, S.H., Lee, S.H., Kim, S.J., Lee, S.I. | | Deposition date: | 2024-02-05 | | Release date: | 2025-02-05 |
|
| PDBID: | 8y7w | | Status: | HPUB -- hold until publication | | Title: | Thymidine Kinase from Staphylococcus aureus(COL strain) | | Authors: | Ashraf, A., Pal, R.K., Hassan, M.I. | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8y7t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 main protease in complex with C2 | | Authors: | Zeng, R., Deng, X.Y., Wang, K., Zhao, X., Yang, S.Y., Lei, J. | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8y7u | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 main protease in complex with C5 | | Authors: | Zeng, R., Deng, X.Y., Yu, J., Yang, S.Y., Lei, J. | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8y85 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rws | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8vxh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8vxj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8vxb | | Status: | HOLD -- hold until a certain date | | Title: | Structure of ANT(6)-Ib from Campylobacter fetus subsp fetus complexed with hydrated streptomycin | | Authors: | Nalam, P., Cook, P., Smith, B. | | Deposition date: | 2024-02-04 | | Release date: | 2025-02-04 | | Sequence: | >Entity 1
MKMRTEKQIYDTILNFAKADDRIRVVTLEGSRTNINIIPDDFQDYDITFFVTDMQSFINSDEWLNVFGERLIMQKPEDMELFPKEEKGYSYLMLFWDGVKIDLTLLPLEVLDEYFTWDKLVKLLLDKDNRVTNIPVPTDEDYYIEHPTARSFDDCCNEFWNTVTYVVKGLCRKEILFAIDHLNNIVRMELLRMISWKVGIEQGYSFSLGKNYKFLERYISPELWKKILATYNMGSYTEMWKSLELCMGIFRMVSKEVAQCLNYLYPDYDKNISNYVIRQKEKYQRDPNSSSVDKLAAALEHHHHHH
|
|
| PDBID: | 8vxg | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | The crystal structure of CYP125MRCA, an ancestrally reconstructed CYP125 enzyme | | Authors: | Doherty, D.Z., Bruning, J.B., Bell, S.G. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8vxi | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | The crystal structure of sitosterol-bound CYP125MRCA | | Authors: | Doherty, D.Z., Bell, S.G. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7b | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a synaptic adhesion protein | | Authors: | Liu, H., Meng, J. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7a | | Status: | HPUB -- hold until publication | | Title: | extracellular domains of a synaptic adhesion receptor in complex with a cell adhesion molecule | | Authors: | Liu, H., Meng, J. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y79 | | Status: | HPUB -- hold until publication | | Title: | extracellular domain of a synaptic adhesion receptor in complex with a long peptide | | Authors: | Liu, H., Meng, J. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y78 | | Status: | HPUB -- hold until publication | | Title: | Extracellular domain of a synaptic adhesion molecule in complex with a short peptide | | Authors: | Liu, H., Meng, J. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
