| PDBID: | 9fag | | Status: | HPUB -- hold until publication | | Title: | Human adenovirus type 36 fiber knob in complex with 4,9-O,5-N-triacetylneuraminic acid | | Authors: | Strebl, M., Liaci, A.M., Stehle, T. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 9fah | | Status: | HPUB -- hold until publication | | Title: | Human adenovirus type 37 fiber knob in complex with 4-O,5-N-diacetylneuraminic acid | | Authors: | Strebl, M., Liaci, A.M., Stehle, T. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 9fa2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 9fab | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh0 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with metal Iron | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 | | Sequence: | >Entity 1
MGSSWSHPQFEKMSTVDTAPQSHYQETKVSEIPIVILKSSATDDVAAHEAIEALKVAGVCIVRNLLDRSTVDKVRQELQPYDKQADSFEGFPKNYCQVAGLLSKSPTYAHSIVGNKLFTAVRNYFLTSTYECWAEKGTWMSVKSPPQLDSTLALYVNPGSGDQGLHRDDATQQNWNSGASEYSLGRDSGCAMMVALTECAREDGTTRFIPGSHLWDYQYDHPSNDDPRIRYAEMRPGDAYLMLSSVIHAGSVNYSTDRRRVLAAVFAARSHLRQVENQYLTYDIETVRTFPTWLQRFMGYSLSKLFQGWVDKKDPLLVVDPNAQPEGEDDGGMKPNEGEHVVEAQI
|
|
| PDBID: | 8zh1 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with a-ketoglutarate | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh9 | | Status: | HPUB -- hold until publication | | Title: | The structure of ELK1-DNA complex | | Authors: | Liu, G., Sun, L.T. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zgz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of inward state Anhydromuropeptide permease (AmpG) | | Authors: | Cho, H.S., Kim, U., Chang, N., Kim, H., Yoo, Y. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zhd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh2 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with a-ketoglutarate and Communesin K | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zgy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zgx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zhb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of N-terminal domain of N-methyl-D-aspartate receptor subunit NR1 in complex with patient-derived antibody | | Authors: | Nomura, N., Kumazaki, K., Amano, Y. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zhe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zhf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zhc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zhg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zhh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 9bqs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 9br4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 9br3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 9br2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
