| PDBID: | 8tra | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 | | Release date: | 2024-12-31 |
|
| PDBID: | 8trb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-09 | | Release date: | 2024-12-31 |
|
| PDBID: | 8trk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 | | Release date: | 2024-12-31 |
|
| PDBID: | 8trf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 | | Release date: | 2025-02-09 |
|
| PDBID: | 8tri | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 |
|
| PDBID: | 8trh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-09 | | Release date: | 2025-02-05 |
|
| PDBID: | 8tr7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-09 | | Release date: | 2024-12-31 |
|
| PDBID: | 8tr8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 | | Release date: | 2024-12-31 |
|
| PDBID: | 8q55 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-08 | | Release date: | 2025-02-08 |
|
| PDBID: | 8q5c | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 12 (1075475) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-08-08 | | Release date: | 2025-02-08 |
|
| PDBID: | 8q54 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | N5-methyl-H4MPT:CoM methyltransferase -coenzyme M complex + CoM | | Authors: | Aziz, I., Vonck, J., Ermler, U. | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8kcy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-08 | | Release date: | 2025-02-08 |
|
| PDBID: | 8q53 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of truncated human Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) in apo form | | Authors: | Kumar, A., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8q56 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8kd1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-08 | | Release date: | 2025-02-08 |
|
| PDBID: | 8tqn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-08 | | Release date: | 2024-08-08 |
|
| PDBID: | 8tqy | | Status: | HPUB -- hold until publication | | Title: | X-Ray Crystal Structure of a dihydromethanopterin reductase (DmrA) from Methylobacterium extorquens AM1 in a H32 Spacegroup at 2.19 Angstrom Resolution | | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbig, M., Collazo, M., Potla, P.S. | | Deposition date: | 2023-08-08 | | Release date: | 2025-01-08 | | Sequence: | >Entity 1
MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8tqw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-08 | | Release date: | 2025-02-05 |
|
| PDBID: | 8q51 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-07 | | Release date: | 2025-02-07 |
|
| PDBID: | 8q4y | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-07 | | Release date: | 2025-02-07 |
|
| PDBID: | 8q4s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phosphoserine phosphatase (SerB) from Brucella melitensis in complex with AP4 and magnesium. | | Authors: | Scaillet, T., Wouters, J. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8tqf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Soybean SHMT8 in complex with PLP-glycine and diglutamylated 5-formyltetrahydrofolate | | Authors: | Owuocha, L.F., Beamer, L.J. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8q4c | | Status: | AUCO -- author corrections pending review | | Title: | Human PEX5 TPR domain in complex with PEX14 KIPSWQIPV peptide | | Authors: | Emmanouilidis, L., Gaussmann, S., Sattler, M. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8kc9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-06 |
|
| PDBID: | 8tq4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
