| PDBID: | 8qix | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium abscessus Phosphopantetheine adenylyltransferase in complex with inhibitor | | Authors: | Thomas, S.E., McCarthy, W.J., Coyne, A.G., Blundell, T.L. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qiy | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium abscessus Phosphopantetheine adenylyltransferase in complex with inhibitor | | Authors: | Thomas, S.E., McCarthy, W.J., Coyne, A.G., Blundell, T.L. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qiz | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of Paradendryphiella salina PL7C alginate lyase mutant H124 soaked with with penta-mannuronic acid | | Authors: | Wilkens, C. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qj1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-12 | | Release date: | 2024-09-12 |
|
| PDBID: | 8qj2 | | Status: | HPUB -- hold until publication | | Title: | Structure of active state MC4R in complex with a potent ligand mimicking nanobody | | Authors: | Busch, A., Jaakola, V.-P., Masiulis, S. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qj5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Levansucrase beta from Pseudomonas syringae pv. actinidiae | | Authors: | Ferraroni, M., Peritore, L. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qj6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cytochrome domain 1 from PgcA | | Authors: | Nash, B.W., Edwards, M.J., Clarke, T.A. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qj8 | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium abscessus Phosphopantetheine adenylyltransferase in complex with inhibitor | | Authors: | Thomas, S.E., McCarthy, W.J., Coyne, A.G., Blundell, T.L. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qj9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qja | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qje | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qji | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GSK3b in complex with N-(4-(5-(1,2,4-oxadiazol-3-yl)thiophen-2-yl)pyridin-2-yl)cyclopropanecarboxamide inhibitor (TW362) | | Authors: | Slugocka, E.A., Grygier, P., Wichur, T., Czarna, A., Wieckowska, A. | | Deposition date: | 2023-09-13 | | Sequence: | >Entity 1
MKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVS(PTR)ICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARENLYFQ
|
|
| PDBID: | 8qjk | | Status: | HPUB -- hold until publication | | Title: | Structure of the cytoplasmic domain of csx23 from Vibrio cholera in complex with cyclic tetra-adenylate (cA4) | | Authors: | McMahon, S.A., McQuarrie, S., Gloster, T.M., Gruschow, S., White, M.F. | | Deposition date: | 2023-09-13 | | Sequence: | >Entity 1
GANAMDEITVVLKSPNGKNIKCPPMPRKDFSRAEVLGYIGMCSGAQRFEIASLKTPKFGENLLKIIKSKGSQSFIVDCTDEEIDQFSAETKSGSNA
>Entity 2
AAAA
|
|
| PDBID: | 8qjl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
