Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
Status search: 12697 results
PDBID:8qr8
Status:HPUB -- hold until publication
Title:Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand
Authors:Gelin, M., Labesse, G.
Deposition date:2023-10-06
PDBID:8qr9
Status:HPUB -- hold until publication
Title:Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand
Authors:Gelin, M., Labesse, G.
Deposition date:2023-10-06
PDBID:8qra
Status:HPUB -- hold until publication
Title:Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand
Authors:Gelin, M., Labesse, G.
Deposition date:2023-10-06
PDBID:8qrb
Status:HPUB -- hold until publication
Title:Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand
Authors:Gelin, M., Labesse, G.
Deposition date:2023-10-06
PDBID:8qrc
Status:HPUB -- hold until publication
Title:Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand
Authors:Gelin, M., Labesse, G.
Deposition date:2023-10-06
PDBID:8qrj
Status:HPUB -- hold until publication
Title:LCC-ICCG PETase mutant H218Y
Authors:Orr, G., Niv, Y., Barakat, M., Boginya, A., Dessau, M., Afriat-Jurnou, L.
Deposition date:2023-10-09
Sequence:

>Entity 1


MDGVLWRVRTAALMAALLALAAWALVWASPSVEAQSNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDGPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEADTVAPVSQYAIPFYQNLPSTTPKVYVELCNASHIAPNSNNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALCDFRTNNRHCQ
PDBID:8qro
Status:HPUB -- hold until publication
Deposition date:2023-10-09
PDBID:8qrp
Status:HPUB -- hold until publication
Deposition date:2023-10-09
PDBID:8qrq
Status:HPUB -- hold until publication
Deposition date:2023-10-09
PDBID:8qrr
Status:HPUB -- hold until publication
Deposition date:2023-10-09
PDBID:8qrs
Status:HPUB -- hold until publication
Deposition date:2023-10-09
PDBID:8qru
Status:HPUB -- hold until publication
Deposition date:2023-10-09
PDBID:8qrv
Status:HPUB -- hold until publication
Deposition date:2023-10-09
PDBID:8qrw
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2023-10-09
PDBID:8qrz
Status:HPUB -- hold until publication
Deposition date:2023-10-09
PDBID:8qs2
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 29 (1076409)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qs3
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 23 (1083848)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qs4
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 22 (1083853)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qs5
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 21 (1075354)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qs6
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 21 (1075354)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qs7
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 70 (1084352)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qs8
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 78 (1084378)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qs9
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 83 (1084383)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qsa
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 86 (1084384)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qsb
Status:AUTH -- processed, waiting for author review and approval
Title:Ternary structure of 14-3-3s, ARAF phosphopeptide (pS214) and compound 86 (1124384).
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10

223532

PDB entries from 2024-08-07

PDB statisticsPDBj update infoContact PDBjnumon