| PDBID: | 8q56 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8q5c | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 12 (1075475) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8q5m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 |
|
| PDBID: | 8q5n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 |
|
| PDBID: | 8q5o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 |
|
| PDBID: | 8q5s | | Status: | HPUB -- hold until publication | | Title: | Anaerobic crystal structure of apo-HIF prolyl hydroxylase 2 (PHD2 181-407)in complex with acetate (ACT) and HIF2alpha-CODD peptide | | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | | Deposition date: | 2023-08-09 |
|
| PDBID: | 8q5y | | Status: | HPUB -- hold until publication | | Title: | cryoEM structure of SARS-CoV2 Spike trimer in complex with Fab23 | | Authors: | Hallberg, M., Das, H. | | Deposition date: | 2023-08-10 |
|
| PDBID: | 8q60 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-10 | | Release date: | 2025-02-10 |
|
| PDBID: | 8q64 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of hydroxylated HIF2alpha-CODD peptide (523-542) bound to apo-HIF prolyl hydroxylase 2 (PHD2 181-407) | | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | | Deposition date: | 2023-08-10 |
|
| PDBID: | 8q65 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-10 |
|
| PDBID: | 8q67 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8q69 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HsRNMT complexed with inhibitor DDD1060606 | | Authors: | Petit, A.P., Fyfe, P.K. | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8q6d | | Status: | HPUB -- hold until publication | | Title: | Anaerobic crystal structure of HIF prolyl hydroxylase 2 (PHD2 181-407) in complex with HIF2alpha-CODD peptide (523-542), Fe(II) and 2-oxoglutarate (2OG) | | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8q6e | | Status: | HPUB -- hold until publication | | Title: | Aerobic crystal structure of HIF prolyl hydroxylase 2 (PHD2 181-407) in complex with Fe(III), 2-oxoglutarate (2OG) and HIF2alpha-CODD peptide | | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8q6i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8q6l | | Status: | HPUB -- hold until publication | | Title: | human Carbonic Anhydrase I in complex with 3,4-dihydro-1H-benzo[c][1,2]oxaborinin-1-ol | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-08-13 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8q6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-14 |
|
| PDBID: | 8q6q | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-14 |
|
| PDBID: | 8q6r | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-14 | | Release date: | 2024-08-14 |
|
| PDBID: | 8q6v | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-15 | | Release date: | 2024-08-15 |
|
| PDBID: | 8q6w | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | LSSmOrange - Directionality of Optical Properties of Fluorescent Proteins | | Authors: | Myskova, J., Brynda, J., Lazar, J. | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8q78 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-15 | | Release date: | 2024-08-15 |
|
| PDBID: | 8q7b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-16 | | Release date: | 2025-02-16 |
|
| PDBID: | 8q7d | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-16 |
|
| PDBID: | 8q7g | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase I in complex with 3,4-dihydro-1H-benzo[c][1,2]oxaborinin-1-ol pH 7.0 | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-08-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
