PDBID: | 9bsf | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor SR-A-171 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9bsg | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor VB-C-20 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9bsh | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-13 | Sequence: | >Entity 1 MNNSKIISKVLLSLSLFTVGASAFVIQDELMQKKHAKAEVSAEEIKKHEEKWNKYYGVNAFNLPKELFSKVDEKDRQKYPYNTIGNVFVKGQTSATGVLIGKNTVLTNRHIAKFANGDPSKVSFRPSINTDDNGNTETPYGEYEVKEILQEPFGAGVDLALIRLKPDQNGVSLGDKISPAKIGTSNDLKDGDKLELIGYPFAHKVNQMHRSEIELTTLSRGLRYYGFTVPGNSGSGIFNSNGELVGIHSSKVSHLDREHQINYGVGIGNYVKRIINEKNE
|
|
PDBID: | 9bsi | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor SR-B-7 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9bsj | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-13 |
|
PDBID: | 9bsk | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-13 |
|
PDBID: | 9bsl | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-13 |
|
PDBID: | 9bsm | Status: | HPUB -- hold until publication | Title: | Staphylococcus aureus exfoliative toxin A D164E variant | Authors: | Holyoak, T., Tran, N. | Deposition date: | 2024-05-13 |
|
PDBID: | 9bsn | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-13 |
|
PDBID: | 9bso | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor SR-B-13 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9bsp | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor VB-C-68 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9bsq | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor VB-C-70 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9bsr | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor YR-B-136B | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9bss | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-13 |
|
PDBID: | 9bst | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor CID8009_5647 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9bsu | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-13 |
|
PDBID: | 9bsv | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-13 |
|
PDBID: | 9bsw | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-14 |
|
PDBID: | 9bsx | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-14 |
|
PDBID: | 9bsy | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-14 |
|
PDBID: | 9bsz | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-14 |
|
PDBID: | 9bt0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-14 |
|
PDBID: | 9bt1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-14 |
|
PDBID: | 9bt2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-14 |
|
PDBID: | 9bt3 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Chorismate Mutase from Mycobacterium tuberculosis in complex with the cyclic peptide inhibitor L2.1 (triclinic form) | Authors: | Liu, L., Lovell, S., Battaile, K.P., Inglese, J. | Deposition date: | 2024-05-14 |
|