PDBID: | 8x5h | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-17 |
|
PDBID: | 8x5o | Status: | HPUB -- hold until publication | Title: | Crystal structure of the post-fusion core of MjHKUr-CoV spike protein. | Authors: | Yun, Z., Xia, Y., Fei, S. | Deposition date: | 2023-11-17 |
|
PDBID: | 8x5p | Status: | HPUB -- hold until publication | Title: | Crystal structure of MjHKUr-CoV spike HR1 in complex with EK1 peptide | Authors: | Yun, Z., Xia, Y., Fei, S. | Deposition date: | 2023-11-17 |
|
PDBID: | 8x5s | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of shikimate kinase of Mycobacterium tuberculosis complex with shikimate-3-phosphate | Authors: | Yadav, A.K., Madhuri, M., Saini, C., Inampudi, K.K., Ethayathulla, A.S., Kumar, M. | Deposition date: | 2023-11-18 | Release date: | 2024-11-18 |
|
PDBID: | 8x5t | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-19 |
|
PDBID: | 8x5u | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-19 |
|
PDBID: | 8x60 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-20 |
|
PDBID: | 8x62 | Status: | HPUB -- hold until publication | Title: | crystal structure of human Mcl-1 kinase domain in complex with RM1 | Authors: | Zhang, Z.M., Wang, L. | Deposition date: | 2023-11-20 |
|
PDBID: | 8x65 | Status: | HPUB -- hold until publication | Title: | Crystal structure of X11P(P71T) xylanase from a metagenome derived gene from sugarcane bagasse collection site | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | Deposition date: | 2023-11-20 | Sequence: | >Entity 1 MAQQCITSSQTGNHGGYFYSFWTDGGGSVSFCLQNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
PDBID: | 8x66 | Status: | HPUB -- hold until publication | Title: | Crystal structure of triple mutant X11P(P71T+N13F+Q34L) xylanase from a metagenome derived gene from sugarcane bagasse collection site | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | Deposition date: | 2023-11-20 | Sequence: | >Entity 1 MAQQCITSSQTGFHGGYFYSFWTDGGGSVSFCLLNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
PDBID: | 8x67 | Status: | HPUB -- hold until publication | Title: | solution structure of Pru p 7 | Authors: | Zheng, J., Aizawa, T., Kumeta, H. | Deposition date: | 2023-11-20 | Sequence: | >Entity 1 GSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPKCP
|
|
PDBID: | 8x68 | Status: | HPUB -- hold until publication | Title: | Complex structure of AtHPPD with YH21002 | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | Deposition date: | 2023-11-20 |
|
PDBID: | 8x69 | Status: | HPUB -- hold until publication | Title: | Complex structure of AtHPPD with YH23010 | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | Deposition date: | 2023-11-20 |
|
PDBID: | 8x6a | Status: | AUTH -- processed, waiting for author review and approval | Title: | Complex structure of AtHPPD with Y18992 | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | Deposition date: | 2023-11-20 |
|
PDBID: | 8x6c | Status: | AUTH -- processed, waiting for author review and approval | Title: | Complex structure of AtHPPD with YH23024 | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | Deposition date: | 2023-11-21 |
|
PDBID: | 8x6d | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the C-terminal TBF1 | Authors: | Gao, Y., Niu, L.W. | Deposition date: | 2023-11-21 | Release date: | 2024-11-21 |
|
PDBID: | 8x6e | Status: | HOLD -- hold until a certain date | Title: | crystal structure of the N-terminal TBF1 | Authors: | Gao, Y., Niu, L.W. | Deposition date: | 2023-11-21 | Release date: | 2024-11-21 |
|
PDBID: | 8x6j | Status: | HPUB -- hold until publication | Title: | The X-ray structure of N-terminal catalytic domain of Thermoplasma acidophilum tRNA methyltransferase Trm56 (Ta0931) in complex with S-adenosyl-L-methionine | Authors: | Fukumoto, S., Hasegawa, T., Ototake, M., Moriguchi, S., Namba, M., Yamagamai, R., Kawamura, T., Hirata, A., Hori, H. | Deposition date: | 2023-11-21 |
|
PDBID: | 8x6k | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-21 |
|
PDBID: | 8x6l | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-21 |
|
PDBID: | 8x6n | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-21 |
|
PDBID: | 8x6o | Status: | HPUB -- hold until publication | Title: | Hemagglutinin in H3N2 influenza viruses | Authors: | Fujii, Y., Sumida, T. | Deposition date: | 2023-11-21 |
|
PDBID: | 8x6q | Status: | HPUB -- hold until publication | Title: | Crystal structure of OsHSL1 L204F/F298L/I335F complexed with 2-acetyl-cyclohexane-2,4-dione | Authors: | Lin, H.-Y., Dong, J., Yang, G.-F. | Deposition date: | 2023-11-21 |
|
PDBID: | 8x6s | Status: | AUTH -- processed, waiting for author review and approval | Title: | FMDV (A/TUR/14/98) in complex with M688F | Authors: | Li, H.Z., Dong, H., Liu, P. | Deposition date: | 2023-11-22 |
|
PDBID: | 8x6t | Status: | HPUB -- hold until publication | Title: | Crystal structure of Peroxiredoxin I in complex with Lithospermic Acid | Authors: | Zhang, H., Luo, C. | Deposition date: | 2023-11-22 |
|