PDBID: | 8p9a | Status: | AUTH -- processed, waiting for author review and approval | Title: | 80S yeast ribosome in complex with Methyllissoclimide | Authors: | Terrosu, S., Yusupov, M., Vanderwal, C. | Deposition date: | 2023-06-05 |
|
PDBID: | 8pa0 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | cvHsp (HspB7) C131S alpha-crystallin domain - filamin C (FLNC) domain 24 complex | Authors: | Wang, Z., Benesch, J.L.P., Allison, T.M., Song, H., McDonough, M.A., Brem, J., Rabe, P. | Deposition date: | 2023-06-06 |
|
PDBID: | 8pdb | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-12 | Release date: | 2024-12-12 |
|
PDBID: | 8pdw | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-12 | Release date: | 2024-12-12 |
|
PDBID: | 8pdx | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-12 | Release date: | 2024-12-12 |
|
PDBID: | 8pe5 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-13 | Release date: | 2024-12-19 |
|
PDBID: | 8pe6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-13 | Release date: | 2024-12-19 |
|
PDBID: | 8pe7 | Status: | HPUB -- hold until publication | Title: | Structure of human PGM5 in complex with Glucose-6-Phosphate | Authors: | Puehringer, D. | Deposition date: | 2023-06-13 | Release date: | 2024-12-19 |
|
PDBID: | 8pef | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-13 | Release date: | 2024-12-13 |
|
PDBID: | 8per | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the Calf domains of Integrin Alpha5 in complex with angiopoietin2 peptide | Authors: | Murthy, A.V., Sipila, T.J.O., Ponna, S.K., Leppanen, V.M.L., Saharinen, P.I. | Deposition date: | 2023-06-14 | Release date: | 2024-12-14 |
|
PDBID: | 8pes | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-14 | Release date: | 2024-12-14 |
|
PDBID: | 8pet | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-14 | Release date: | 2024-12-14 |
|
PDBID: | 8pf6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-15 | Release date: | 2024-12-15 |
|
PDBID: | 8pf7 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-15 | Release date: | 2024-12-15 |
|
PDBID: | 8pfs | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-16 | Release date: | 2024-12-16 |
|
PDBID: | 8pg1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-17 | Release date: | 2024-12-17 |
|
PDBID: | 8phc | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-19 | Release date: | 2024-12-19 |
|
PDBID: | 8phh | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Cryo-EM structure of Atkinsonella Hypoxylon Virus-like particles. | Authors: | Byrne, M.J., Sainsbury, F. | Deposition date: | 2023-06-19 |
|
PDBID: | 8phm | Status: | HPUB -- hold until publication | Title: | Oxalate-bound cobalt(II) human carbonic anhydrase II | Authors: | Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C. | Deposition date: | 2023-06-20 | Release date: | 2024-12-20 | Sequence: | >Entity 1 NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
PDBID: | 8pik | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-21 | Release date: | 2024-12-21 |
|
PDBID: | 8pin | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pio | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pir | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pis | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pkn | Status: | HPUB -- hold until publication | Title: | CryoEM structure of catalytic domain of human HMG-CoA reductase with its inhibitor atorvastatin | Authors: | Manikandan, K., Van Rooyen, J. | Deposition date: | 2023-06-27 | Release date: | 2025-01-03 |
|