| PDBID: | 8kc0 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -NB8 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-05 |
|
| PDBID: | 8kc1 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -NX5 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-05 |
|
| PDBID: | 8kc3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-05 |
|
| PDBID: | 8kc4 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -NA05 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8kc5 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -T09 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8kc8 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -T11 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8kc9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-06 |
|
| PDBID: | 8kcd | | Status: | HPUB -- hold until publication | | Title: | Complex of DDM1-nucleosome(H2A.W) complex with DDM1 bound to SHL2 and SHL-2 | | Authors: | Zhang, H., Zhang, Y. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8kce | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8kcg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Sus scrofa complex I close state 3 from supercomplex I+III2+IV in the presence of proguanil | | Authors: | Teng, F., Hu, Y.Q., Zhou, L. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8kch | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Sus scrofa complex I close state 2 from supercomplex I+III2+IV in the presence of proguanil | | Authors: | Teng, F., Hu, Y.Q., Zhou, L. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8kcj | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -N7 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8kck | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -N9 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-07 | | Sequence: | >Entity 1
GAEAAAAAAVTAELRAFRAAGGTVELEDLPVTPETLARAEAALARLPPESVAVETYTVPAPTPEAFLAALEAALARLAAEGLPAILLRVVDADGNLVGSILVAAAGPPAESAAATGRVLTIYVASSPEGLKVARGLAIETRDAGGLALAIGASGAWALAGLAGALALARRLAEAHGAPVRVVTIGDPANPTDAALAAAIRAAYAAALEHHHHHH
|
|
| PDBID: | 8kcn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8kco | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8kcp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8kcr | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of E447A Acyl-CoA Dehydrogenase FadE15 mutant from Mycobacteria tuberculosis in complex with C18CoA | | Authors: | Liu, X., Chen, R., Ma, M. | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8kcs | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human gamma-secretase in complex with BMS906024 | | Authors: | Guo, X., Li, H., Kai, U., Yan, C., Lei, J., Zhou, R., Shi, Y. | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8kct | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human gamma-secretase in complex with Nirogacestat | | Authors: | Guo, X., Li, H., Kai, U., Yan, C., Lei, J., Zhou, R., Shi, Y. | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8kcu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human gamma-secretase in complex with MK-0752 | | Authors: | Guo, X., Li, H., Kai, U., Yan, C., Lei, J., Zhou, R., Shi, Y. | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8kcv | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of UDA01-CAAMDDFQL | | Authors: | Tang, Z., Zhang, N. | | Deposition date: | 2023-08-08 | | Release date: | 2024-08-08 |
|
| PDBID: | 8kcy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-08 | | Release date: | 2025-02-08 |
|
| PDBID: | 8kd0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SAR11_0769 from ''Candidatus Pelagibacter ubique'' HTCC1062 bound to a co-purified ligand, beta-galactopyranose | | Authors: | Clifton, B.E., Laurino, P. | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8kd1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-08 | | Release date: | 2025-02-08 |
|
| PDBID: | 8kd8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 |
|
