PDBID: | 8vhg | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-01 |
|
PDBID: | 8vhh | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhi | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhj | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhk | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhn | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vho | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhp | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhq | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhr | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhs | Status: | AUTH -- processed, waiting for author review and approval | Title: | X-ray Structure of a De Novo Designed Self Assembled Peptide Tetramer Featuring a Cu(His)4(H2O) Coordination Motif | Authors: | Chakraborty, S., Mitra, S., Prakash, D., Prasad, P. | Deposition date: | 2024-01-02 |
|
PDBID: | 8vht | Status: | HPUB -- hold until publication | Title: | Cryo EM structure of a soybean CesA3 homotrimer | Authors: | Ho, R., Palliniti, P., Zimmer, J. | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhu | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhv | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhw | Status: | HPUB -- hold until publication | Title: | Neutron Structure of Peroxide-Soaked Trp161Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-01-02 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVFEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 8vhx | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM of neck of bacteriophage Chi | Authors: | Sonani, R.R., Esteves, N.C., Scharf, B.E., Egelman, E.H. | Deposition date: | 2024-01-02 | Release date: | 2025-01-02 |
|
PDBID: | 8vhy | Status: | HPUB -- hold until publication | Title: | Neutron Structure of Reduced Trp161Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-01-02 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVFEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 8vhz | Status: | HPUB -- hold until publication | Title: | Cryo EM structure of a soybean CesA1 homotrimer | Authors: | Ho, R., Palliniti, P., Zimmer, J. | Deposition date: | 2024-01-02 |
|
PDBID: | 8vi0 | Status: | HPUB -- hold until publication | Title: | Cryo EM structure of a soybean CesA6 homotrimer | Authors: | Ho, R., Palliniti, P., Zimmer, J. | Deposition date: | 2024-01-02 |
|
PDBID: | 8vi1 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-02 | Release date: | 2025-01-02 |
|
PDBID: | 8vi6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-03 |
|
PDBID: | 8vi7 | Status: | HPUB -- hold until publication | Title: | Bos Taurus Mitochondrial BC1 in complex with Atovaquone | Authors: | Xia, D., Zhou, F., Esser, L. | Deposition date: | 2024-01-03 |
|
PDBID: | 8vi8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-03 |
|
PDBID: | 8vi9 | Status: | HPUB -- hold until publication | Title: | NEMO IKK-binding domain with bound small molecule fragment | Authors: | Kennedy, A.E. | Deposition date: | 2024-01-03 | Sequence: | >Entity 1 GSWSVKELEDKNEELLSEIAHLKNEVARLKKLLQRCLAANQELRDAMRQSNQILRERAEELLHFQASQREEKEFLMSKFQEARKLVERLGLEKLELEDKNEELLSEIAHLKNEVARLKKLVGER
|
|
PDBID: | 8via | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-03 |
|