| PDBID: | 8rzu | | Status: | HPUB -- hold until publication | | Title: | Structure of human SETD2 L1609P mutant in complex with SAM and H3K36M peptide | | Authors: | Mechaly, A.E., Michail, C., Haouz, A., Rodrigues-Lima, F. | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8rzx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8rzz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 | | Sequence: | >Entity 1
MDLAKLGLKEVMPTKINLEGLVGDHAFSMEGVGEGNILEGTQEVKISVTKGAPLPFAFDIVSVAF(CRO)NRAYTGYPEEISDYFLQSFPEGFTYERNIRYQDGGTAIVKSDISLEDGKFIVNVDFKAKDLRRMGPVMQQDIVGMQPSYESMYTNVTSVIGECIIAFKLQTGKHFTYHMRTVYKSKKPVETMPLYHFIQHRLVKTNVDTASGYVVQHETAIAAHSTIKKIEGSLP
>Entity 2
MTSKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAENAVIFLHGNATSSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGAALAFHYAYEHQDRIKAIVHMESVVDVIESWDEWPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKLFIESDPGFFSNAIVEGAKKFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQSGLEVLFQ
|
|
| PDBID: | 8s00 | | Status: | HPUB -- hold until publication | | Title: | CpKRS complexed with lysine and an inhibitor | | Authors: | Dawson, A., Baragana, B., Caldwell, N. | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8s02 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8s05 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | ArnAB complex an archaeal ortholog of the Sec23/24 core motif | | Authors: | Korf, L., Steinchen, W., Watad, M., Bezold, F., Vogt, M.S., Selbach, L., Penner, A., Tourte, M., Hepp, S., Albers, S.V., Essen, L.-O. | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8s08 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8s09 | | Status: | HPUB -- hold until publication | | Title: | H. sapiens MCM2-7 double hexamer bound to double stranded DNA | | Authors: | Greiwe, J.F., Weissmann, F., Diffley, J.F.X., Costa, A. | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8s0a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8s0b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8s0c | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8s0d | | Status: | HPUB -- hold until publication | | Title: | H. sapiens MCM bound to double stranded DNA and ORC1-6 | | Authors: | Greiwe, J.F., Weissmann, F., Diffley, J.F.X., Costa, A. | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8s0e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8s0f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8s0g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-14 |
|
| PDBID: | 8s0r | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-14 | | Release date: | 2025-02-14 |
|
| PDBID: | 8s0t | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-14 | | Release date: | 2025-02-14 |
|
| PDBID: | 8s0v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Cryptosporidium parvum - Trypanosoma cruzi mutant lysyl tRNA synthetase in complex with inhibitor | | Authors: | Dawson, A., Wyllie, S. | | Deposition date: | 2024-02-14 |
|
| PDBID: | 8s0w | | Status: | HPUB -- hold until publication | | Title: | MSOX movie series dataset 1 (0.57 MGy) for as isolated BrJNiR (Cu containing nitrite reductase (NirK) from Bradyrhizobium japonicum USDA110) at pH 8. | | Authors: | Rose, S.L., Ferroni, F.M., Horrell, S., Brondino, C.D., Eady, R.R., Jaho, S., Hough, M.A., Owen, A.L., Antonyuk, S.V., Hasnain, S.S. | | Deposition date: | 2024-02-14 |
|
| PDBID: | 8s0x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-14 |
|
| PDBID: | 8s0y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-14 |
|
| PDBID: | 8s0z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-14 |
|
| PDBID: | 8s10 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-14 |
|
| PDBID: | 8s11 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-14 |
|
| PDBID: | 8s12 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
