Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
Status search: 25912 results
PDBID:9bza
Status:PROC -- to be processed
Title:Class 18 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-24
PDBID:9c05
Status:AUTH -- processed, waiting for author review and approval
Title:UIC-1+PhEt+PhiPr+o-xylene+benzene
Authors:Heinz-Kunert, S.L.
Deposition date:2024-05-24
PDBID:9bzd
Status:PROC -- to be processed
Title:Class 23 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-24
PDBID:9c07
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2024-05-24
PDBID:9bzn
Status:AUTH -- processed, waiting for author review and approval
Title:High resolution structure of class A Beta-lactamase from Bordetella bronchiseptica RB50
Authors:Maltseva, N., Kim, Y., Endres, M., Joachimiak, A., Center for Structural Biology of Infectious Diseases (CSBID)
Deposition date:2024-05-24
PDBID:9byu
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2024-05-24
PDBID:9bzg
Status:HPUB -- hold until publication
Title:Targeting N-Myc in Neuroblastoma with Selective Aurora Kinase A Degraders
Authors:Baker, Z.D., Tang, J., Shi, K., Aihara, H., Levinson, N.M., Harki, D.A.
Deposition date:2024-05-24
PDBID:9bys
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2024-05-24
PDBID:9bze
Status:PROC -- to be processed
Title:Class 26 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-24
PDBID:9bzs
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of cardiac amyloid fibril from a variant ATTR V30M amyloidosis patient
Authors:Nguyen, A.B., Afrin, S., Yakubovska, A., Saelices, L.
Deposition date:2024-05-24
Release date:2025-05-24
PDBID:9bzf
Status:PROC -- to be processed
Title:Class 28 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-24
PDBID:9bzh
Status:PROC -- to be processed
Title:Class 29 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-24
PDBID:9byt
Status:PROC -- to be processed
Title:Class 1 model for turnover condition of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-24
PDBID:9bzi
Status:PROC -- to be processed
Title:Class 31 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-24
PDBID:9bzj
Status:PROC -- to be processed
Title:Class 40 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-24
PDBID:9bzl
Status:HPUB -- hold until publication
Title:Targeting N-Myc in Neuroblastoma with Selective Aurora Kinase A Degraders
Authors:Baker, Z.D., Tang, J., Shi, K., Aihara, H., Levinson, N.M., Harki, D.A.
Deposition date:2024-05-24
Sequence:

>Entity 1


GAMESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRT(TPO)LAGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNSQNKESASKQS
PDBID:9bzk
Status:PROC -- to be processed
Title:Class 43 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-24
PDBID:9bzm
Status:PROC -- to be processed
Title:Class 45 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-24
PDBID:9bzo
Status:PROC -- to be processed
Title:Class 50 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-24
PDBID:9c09
Status:HPUB -- hold until publication
Title:Structure of K2P13.1 (THIK1) S136P in lipid nanodisc
Authors:Roy-Chowdhury, S., Adberemane-Ali, F., Minor, D.L.
Deposition date:2024-05-24
PDBID:9c0a
Status:AUTH -- processed, waiting for author review and approval
Title:Effect of glutathione on the stability, dynamics and catalysis of two different classes of glutathione transferases from Taenia solium
Authors:Miranda-Blancas, R., Sanchez-Juarez, C., Sanchez-Perez, L., Zubillaga, R., Flores-Lopez, R., Landa, A., Miranda-Blancas, R., Garcia-Gutierrez, P., Rudino-Pinera, E.
Deposition date:2024-05-24
PDBID:9bzq
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of Class A Beta-lactamase from Bordetella bronchiseptica RB50 in a complex with Avibactam
Authors:Maltseva, N., Kim, Y., Endres, M., Joachimiak, A.
Deposition date:2024-05-24
PDBID:9bzr
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of Class A Beta-lactamase from Bordetella bronchiseptica RB50 in a complex with clavulonate
Authors:Maltseva, N., Kim, Y., Endres, M., Joachimiak, A., Center for Structural Biology of Infectious Diseases (CSBID)
Deposition date:2024-05-24
PDBID:9c08
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of Sialyl transferase from Pasturella Multocida
Authors:Subramanian, R., Dhanabalan, K.
Deposition date:2024-05-24
PDBID:9fgi
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2024-05-24
Release date:2025-05-24

220760

PDB entries from 2024-06-05

PDB statisticsPDBj update infoContact PDBjnumon