| PDBID: | 9eds | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9edt | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9edu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Streptavidin-S112C bound to Cu(II)dpea cofactor | | Authors: | Minnetian, N.M., Borovik, A.S., Follmer, A.H. | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9ee6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9eeb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9eec | | Status: | HPUB -- hold until publication | | Title: | X-ray crystallographic structure of a beta-hairpin peptide mimic derived from Abeta 16-36 ORN-LYS-LEU-VAL-H7V-PHE-ALA-GLU-ORN-ALA-ILE-ILE-GLY-LEU-MET-VAL | | Authors: | Kreutzer, A.G., Zhu, J., Nowick, J.S. | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9ee8 | | Status: | HPUB -- hold until publication | | Title: | GPCR A family receptor | | Authors: | Bi, M., Wang, X., Ye, L., Cheng, Y. | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kn1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kmt | | Status: | HPUB -- hold until publication | | Title: | Bat SARSr-CoV RaTG15 Nsp1 bound to the Human 40S Ribosomal subunit-State1 | | Authors: | Yuan, S., Yan, R., Wu, M. | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kmu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kmv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kmw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kmx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kmy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kmz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kn0 | | Status: | HPUB -- hold until publication | | Title: | Bat MERSr-CoV NL140422 Nsp1 bound to the Human 40S Ribosomal subunit-State2 | | Authors: | Yuan, S., Yan, R., Wu, M. | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9knh | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-18 | | Release date: | 2025-11-18 |
|
| PDBID: | 9kng | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-18 | | Release date: | 2025-11-18 |
|
| PDBID: | 9knf | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-18 | | Release date: | 2025-11-18 |
|
| PDBID: | 9kn2 | | Status: | HPUB -- hold until publication | | Title: | Crystallization of zinc metalloproteinase PepO from Porphyromonas gingivalis | | Authors: | Feng, C.Y., Feng, C.Y. | | Deposition date: | 2024-11-18 | | Sequence: | >Entity 1
NKGQTNDTDRKREPVPAIDLSAMDTSVRPQDDFYRYCNGNWMKNNPLKPAYSRYGSFDILHDSTLERVHLIVDNLAAGQHEVGTNEYRIATLYRQAMDSIKRNKDGAAPLKEDLQKIEAIADRAAMVKYAAAKDNMGGSTFFGSYVYADAKNSEMNIFHITQTGLALDNRDYYLKQDAKSQQIREAYVAYLNKIAKLAGYDDEAATRIAKNAMKMETELAQICYSKEELRDTHRNYNKMAVKEFTNKYQGFDWTTYLADRQLTTLEEWDVEQLDFFKKFDSWFAKADLNEMRDYLLAGTISGAASYLSDDFEQARFDFFGKTLSGTTEMHPRWKRSVGMVSSFLGEALGEVYVKQYFPPEAKERMLKLVKNLQTALGERINMLTWMGDSTKMKAQEKLNSFIIKIGYPDKWKDYSKMEIKGDSYYADIKRASKWMHDDNMADLGKTVDRERWLMNPQDVNAYYNPTTNEICFPAAILQPPFFNMDADDAVNYGGIGVVIGHEMTHGFDDQGRNFDKDGNMINWWTAEDAQKFETTARKLADQFSEIYVADGVRANGNMTLGENIADQGGLLISYLAFRNAAKGEVMEEIDGFTPDQRFFIGYARLWGQNIRPEEVLRLTQIDVHSLGELRVNQALRNIEAFYEAFNIQPTDKMYLEPEKRVVVW
|
|
| PDBID: | 9kne | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-18 | | Release date: | 2025-11-18 |
|
| PDBID: | 9knc | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-18 | | Release date: | 2025-11-18 |
|
| PDBID: | 9knd | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-18 | | Release date: | 2025-11-18 |
|
| PDBID: | 9kn9 | | Status: | HPUB -- hold until publication | | Title: | NSD2-PWWP1 domain bound with compound 1. | | Authors: | Huang, Y., Li, Y., Min, J. | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kna | | Status: | HPUB -- hold until publication | | Title: | NSD2-PWWP1 domain bound with compound 6 | | Authors: | Huang, Y., Li, Y., Min, J. | | Deposition date: | 2024-11-18 |
|
