| PDBID: | 9ece | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-14 | | Release date: | 2025-11-14 |
|
| PDBID: | 9ecg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9ech | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9eck | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9ecf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9ecl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9ecm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9ecp | | Status: | HPUB -- hold until publication | | Title: | Structure of the native human NCP purified from HEK293 cells | | Authors: | Reid, X.J., Sobti, M., Low, J.K.K., Stewart, A.G., Mackay, J.P. | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kks | | Status: | HOLD -- hold until a certain date | | Title: | Solution NMR structure of Pseudoazurin | | Authors: | Yamaguchi, T., Obara, Y., Fujikawa, K., Yamasaki, K., Kohzuma, T. | | Deposition date: | 2024-11-14 | | Release date: | 2025-11-14 | | Sequence: | >Entity 1
ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN
|
|
| PDBID: | 9kl3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kl2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pleurocybella porrigens lectin (PPL) in complex with GalNAc | | Authors: | Adachi, D., Ishimoto, N., Kawabata, H., Mizutani, K., Park, S.-Y., Tame, J.R.H., Kamata, K. | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kkn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kko | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9klb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9klc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kl7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kl4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9klm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kky | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kkq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kkp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Horse spleen L-ferritin mutant (E53F/E56F/E57F/R59F/E60F/E63F) with Nile Red | | Authors: | Suzuki, T., Hishikawa, Y., Maity, B., Abe, S., Ueno, T. | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kl6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kln | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of ChCas12b-sgRNA-target DNA ternary complex (Complex-A) | | Authors: | Li, Y., Li, J., Pei, X., Gan, J., Lin, J. | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kkw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kl0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-14 |
|
