| PDBID: | 9brm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL077-22 | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9brn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL050-22 | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9bra | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9bro | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL030-22 | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9brp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL047-22 | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9brb | | Status: | HPUB -- hold until publication | | Title: | Synaptic Vesicle V-ATPase with synaptophysin and SidK, State 1 | | Authors: | Coupland, C.E., Rubinstein, J.L. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9brt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Intact V-ATPase State 1 and synaptophysin complex in mouse brain isolated synaptic vesicles | | Authors: | Wang, C., Jiang, W., Yang, K., Wang, X., Guo, Q., Brunger, A.T. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9brq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Intact V-ATPase State 3 and synaptophysin complex in mouse brain isolated synaptic vesicles | | Authors: | Wang, C., Jiang, W., Yang, K., Wang, X., Guo, Q., Brunger, A.T. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9brr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Intact V-ATPase State 3 and synaptophysin knock-out isolated synaptic vesicles | | Authors: | Wang, C., Jiang, W., Yang, K., Wang, X., Guo, Q., Brunger, A.T. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9brv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SARS-CoV-2 Papain-like Protease (PLpro) with Fragment 5 | | Authors: | Amporndanai, K., Zhao, B., Fesik, S.W. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9brx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SARS-CoV-2 Papain-like Protease (PLpro) with Fragment 10 | | Authors: | Amporndanai, K., Zhao, B., Fesik, S.W. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9brw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SARS-CoV-2 Papain-like Protease (PLpro) with Fragment 7 | | Authors: | Amporndanai, K., Zhao, B., Fesik, S.W. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9fb2 | | Status: | HPUB -- hold until publication | | Title: | Gcase in complex with small molecule inhibitor 1 | | Authors: | Tisi, D., Cleasby, A. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9fb3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Aldose Reductase in Complex with a Covalent Ligand | | Authors: | Klee, L.-S., Heine, A., Glinca, S. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9fb1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Rv2242 regulator N-terminal fragment (1-160) | | Authors: | Megalizzi, V., Tanina, A., Grosse, C., Mirgaux, M., Legrand, P., Dias Mirandela, G., Wohlkonig, A., Bifani, P., Wintjens, R. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9fb4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-11 |
|
| PDBID: | 8zh2 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with a-ketoglutarate and Communesin K | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh0 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with metal Iron | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 | | Sequence: | >Entity 1
MGSSWSHPQFEKMSTVDTAPQSHYQETKVSEIPIVILKSSATDDVAAHEAIEALKVAGVCIVRNLLDRSTVDKVRQELQPYDKQADSFEGFPKNYCQVAGLLSKSPTYAHSIVGNKLFTAVRNYFLTSTYECWAEKGTWMSVKSPPQLDSTLALYVNPGSGDQGLHRDDATQQNWNSGASEYSLGRDSGCAMMVALTECAREDGTTRFIPGSHLWDYQYDHPSNDDPRIRYAEMRPGDAYLMLSSVIHAGSVNYSTDRRRVLAAVFAARSHLRQVENQYLTYDIETVRTFPTWLQRFMGYSLSKLFQGWVDKKDPLLVVDPNAQPEGEDDGGMKPNEGEHVVEAQI
|
|
| PDBID: | 8zh1 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with a-ketoglutarate | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The structure of ELK1-DNA complex | | Authors: | Liu, G., Sun, L.T. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zgz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of inward state Anhydromuropeptide permease (AmpG) | | Authors: | Cho, H.S., Kim, U., Chang, N. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zhd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zgy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-10 |
|
